Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

GPX2

Uniprot No.

P38143

Research Area

Cell Biology

Alternative Names

Glutathione peroxidase homolog 2 (GPx 2)

Species

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Source

E.coli

Expression Region

1-162aa

Target Protein Sequence

MTTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVILGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLGFKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLLSK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

23.4 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Step up your research in cell biology with the Recombinant Saccharomyces cerevisiae GPX2. Extracted from the Baker's yeast strain (Saccharomyces cerevisiae, strain ATCC 204508 / S288c), this full-length protein plays a fundamental role in oxidative stress response, thus contributing to understanding the intricate cellular pathways and redox balance. The protein is a homolog of the ubiquitous Glutathione peroxidase, enabling you to investigate mechanisms related to the regulation of cellular peroxide levels and defense against oxidative damage.

This recombinant GPX2, expressed in E.coli, covers the full-length sequence of 1-162 amino acids and boasts an N-terminal 10xHis-tag and a C-terminal Myc-tag. These tags facilitate easy tracking and purification of the protein in diverse experimental setups. Ensuring a purity greater than 85% as established by SDS-PAGE, this product is available in both liquid and lyophilized powder forms to suit your experimental convenience. With the Recombinant Saccharomyces cerevisiae GPX2, witness a fusion of advanced science and quality, designed for your research success.

Target Background

Function

Glutathione peroxidase-like protein that protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress. Plays an important role in the oxidative stress-induced response in the presence of Ca(2+). Has peroxidase activity using preferentially thioredoxin as a reducing power. The redox state of the mitochondrial GPX2 is regulated by TRX1 and TRX2 (cytoplasmic thioredoxin), and by TRX3 (mitochondrial matrix thioredoxin). Involved in sporulation.

Gene References into Functions

Gpx2 was found to exist in the cytoplasm and mitochondria. PMID: 21763276
determination that Gpx2 codes for an atypical 2-Cys peroxiredoxin and is likely to play an important role in the protection of cells from oxidative stress in the presence of Ca2+ PMID: 16251189

Subcellular Location

Cytoplasm. Nucleus. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side. Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.

Protein Families

Glutathione peroxidase family

Database Links

KEGG: sce:YBR244W

STRING: 4932.YBR244W

Code	CSB-EP009867SVGb1
Abbreviation	Recombinant Saccharomyces cerevisiae GPX2 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Saccharomyces cerevisiae Glutathione peroxidase-like peroxiredoxin 2 (GPX2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage