Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
Glutathione peroxidase homolog 2 (GPx 2)
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Region
1-162aa
Target Protein Sequence
MTTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVILGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLGFKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLLSK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Step up your research in cell biology with the Recombinant Saccharomyces cerevisiae GPX2. Extracted from the Baker's yeast strain (Saccharomyces cerevisiae, strain ATCC 204508 / S288c), this full-length protein plays a fundamental role in oxidative stress response, thus contributing to understanding the intricate cellular pathways and redox balance. The protein is a homolog of the ubiquitous Glutathione peroxidase, enabling you to investigate mechanisms related to the regulation of cellular peroxide levels and defense against oxidative damage.
This recombinant GPX2, expressed in E.coli, covers the full-length sequence of 1-162 amino acids and boasts an N-terminal 10xHis-tag and a C-terminal Myc-tag. These tags facilitate easy tracking and purification of the protein in diverse experimental setups. Ensuring a purity greater than 85% as established by SDS-PAGE, this product is available in both liquid and lyophilized powder forms to suit your experimental convenience. With the Recombinant Saccharomyces cerevisiae GPX2, witness a fusion of advanced science and quality, designed for your research success.