Recombinant Saccharomyces cerevisiae Glutathione peroxidase-like peroxiredoxin 2 (GPX2)

In Stock
Code CSB-EP009867SVGb1
Abbreviation Recombinant Saccharomyces cerevisiae GPX2 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Glutathione peroxidase homolog 2 (GPx 2)
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Source
E.coli
Expression Region
1-162aa
Target Protein Sequence
MTTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVILGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLGFKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLLSK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.4 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Step up your research in cell biology with the Recombinant Saccharomyces cerevisiae GPX2. Extracted from the Baker's yeast strain (Saccharomyces cerevisiae, strain ATCC 204508 / S288c), this full-length protein plays a fundamental role in oxidative stress response, thus contributing to understanding the intricate cellular pathways and redox balance. The protein is a homolog of the ubiquitous Glutathione peroxidase, enabling you to investigate mechanisms related to the regulation of cellular peroxide levels and defense against oxidative damage.

This recombinant GPX2, expressed in E.coli, covers the full-length sequence of 1-162 amino acids and boasts an N-terminal 10xHis-tag and a C-terminal Myc-tag. These tags facilitate easy tracking and purification of the protein in diverse experimental setups. Ensuring a purity greater than 85% as established by SDS-PAGE, this product is available in both liquid and lyophilized powder forms to suit your experimental convenience. With the Recombinant Saccharomyces cerevisiae GPX2, witness a fusion of advanced science and quality, designed for your research success.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Glutathione peroxidase-like protein that protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress. Plays an important role in the oxidative stress-induced response in the presence of Ca(2+). Has peroxidase activity using preferentially thioredoxin as a reducing power. The redox state of the mitochondrial GPX2 is regulated by TRX1 and TRX2 (cytoplasmic thioredoxin), and by TRX3 (mitochondrial matrix thioredoxin). Involved in sporulation.
Gene References into Functions
  1. Gpx2 was found to exist in the cytoplasm and mitochondria. PMID: 21763276
  2. determination that Gpx2 codes for an atypical 2-Cys peroxiredoxin and is likely to play an important role in the protection of cells from oxidative stress in the presence of Ca2+ PMID: 16251189
Subcellular Location
Cytoplasm. Nucleus. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side. Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Protein Families
Glutathione peroxidase family
Database Links

KEGG: sce:YBR244W

STRING: 4932.YBR244W

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*