Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
DmSUMO 1; Small Ubiquitin-like modifier; SMT3; SMT3_YEAST; Ubiquitin like protein of the SUMO family; Ubiquitin like protein SMT3; Ubiquitin-like protein SMT3
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Protein Sequence
SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Baker's yeast SMT3 protein is encoded by the gene of SMT3 (2-98aa). The gene of SMT3 was cloned in a system (E.coli) that supported the expression of SMT3 and translation of messenger RNA. Modification of SMT3 by recombinant DNA technology could lead to the expression of the target protein. The protein was fused with N-terminal 6xHis-SUMO tag in the production. The purity is 90% determined by SDS-PAGE.
SMT3 is a protein coding gene that encodes Ubiquitin-like protein SMT3. According to some studies, SMT3 may have the following features.
A new factor required for the SUMO1/Smt3 conjugation of yeast membrane proteins. The ubiquitin-like proteins SMT3 and SUMO-1 are bound by the UBC9 E2 enzyme. Yeast ULP2 (SMT4) gene encodes a new protease, which is specific for ubiquitin-like Smt3 protein. Yeast Ull1/Siz1 is a new type of SUMO1/Smt3 ligase, used for septin components, and acts as an adaptor between the ligase and the substrate. A new type of mammalian Smt3-specific isopeptidase 1 (SMT3IP1) localizes to nucleosomes during interphase. Sterol methyltransferases SMT1, SMT2 and SMT3 affect the development of Arabidopsis thaliana through non-sterol products. The combination of Smt3 and Dorsal may enhance the immune response of fruit flies.
