Recombinant Saccharomyces cerevisiae Ubiquitin-like protein SMT3 (SMT3)

In Stock
Code CSB-YP615489SVG
Abbreviation Recombinant Saccharomyces cerevisiae SMT3 protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SMT3
Uniprot No.
Research Area
Others
Alternative Names
DmSUMO 1; Small Ubiquitin-like modifier; SMT3; SMT3_YEAST; Ubiquitin like protein of the SUMO family; Ubiquitin like protein SMT3; Ubiquitin-like protein SMT3
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Source
Yeast
Expression Region
2-98aa
Target Protein Sequence
SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Ubiquitin-like protein SMT3 CSB-YP615489SVG is a recombinant Saccharomyces cerevisiae full-length of mature SMT3 protein containing amino acid residues of 2-98. It is produced in the yeast cells through Eukaryotic expression and fused with a 6xHis-tag at the N-terminus. And it has high purity of up to 90% determined by SDS-PAGE. Its predicted molecular weight is 13.1 kDa, but the actual observed molecular mass via SDS-PAGE analysis is slightly higher due to post-transcriptional modifications such as glycosylation. This recombinant SMT3 protein is in-stock, allowing for continuous sourcing and eliminating the intermediate waiting periods for protein preparation. This SMT3 protein not only acts as an immunogen for antibody production but also finds uses in the studies of microbiology.

SMT3 is the only small ubiquitin-like modifier (SUMO) protein of Saccharomyces cerevisiae. Like ubiquitin, SMT3 consists of multiple lysine residues that could serve as sites for synthesis of topologically and functionally distinct chains. TongLiu etc. demonstrated that SMT3 plays critical roles in the asexual development, environmental adaptation, and pathogenicity of Beauveria bassiana.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Not known; suppressor of MIF2 mutations.
Gene References into Functions
  1. the library of Smt3 mutants represents a valuable resource for further exploring the functions of sumoylation in cellular stress response and other SUMO-dependent pathways. PMID: 28166236
  2. Ulp2 controls the dynamic range of SUMO chain lengths by trimming them from the distal ends PMID: 25833950
  3. Cdk1 and SUMO (Smt3) regulate Swe1 stability PMID: 21151918
  4. the Zn(2+) motif of E1 has a role in SUMO adenylation PMID: 20501649
  5. there are a broad array of cellular processes regulated by SUMO conjugation PMID: 15590687
  6. A model is proposed for the positive control of the centromeric pool of Top2p, required for high minichromosome segregation fidelity, by Smt3p modification. PMID: 16204216

Show More

Hide All

Protein Families
Ubiquitin family, SUMO subfamily
Database Links

KEGG: sce:YDR510W

STRING: 4932.YDR510W

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*