Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
DmSUMO 1; Small Ubiquitin-like modifier; SMT3; SMT3_YEAST; Ubiquitin like protein of the SUMO family; Ubiquitin like protein SMT3; Ubiquitin-like protein SMT3
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Protein Sequence
SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Ubiquitin-like protein SMT3 CSB-YP615489SVG is a recombinant Saccharomyces cerevisiae full-length of mature SMT3 protein containing amino acid residues of 2-98. It is produced in the yeast cells through Eukaryotic expression and fused with a 6xHis-tag at the N-terminus. And it has high purity of up to 90% determined by SDS-PAGE. Its predicted molecular weight is 13.1 kDa, but the actual observed molecular mass via SDS-PAGE analysis is slightly higher due to post-transcriptional modifications such as glycosylation. This recombinant SMT3 protein is in-stock, allowing for continuous sourcing and eliminating the intermediate waiting periods for protein preparation. This SMT3 protein not only acts as an immunogen for antibody production but also finds uses in the studies of microbiology.
SMT3 is the only small ubiquitin-like modifier (SUMO) protein of Saccharomyces cerevisiae. Like ubiquitin, SMT3 consists of multiple lysine residues that could serve as sites for synthesis of topologically and functionally distinct chains. TongLiu etc. demonstrated that SMT3 plays critical roles in the asexual development, environmental adaptation, and pathogenicity of Beauveria bassiana.
