Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin

Code CSB-YP307648LKN
Product Type Recombinant Protein
Size US$2959
Uniprot No. P85101
Relevance Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells. Inhibits cell-free translation in rabbit reticulocyte lysate system with an IC50 of 0.17 nM.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Silene chalcedonica (Maltese-cross) (Lychnis chalcedonica)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence RPSWTVDSDSAKYSSFLDSLREEFGRGTPKVCNIPVTKKANNDKFVLVNLVLPFNRNTITLAFRASDAYLVGFQDRDSKTNKLRANFFSDEYRALSGKYKSIFTDAEVLAPALPCASTYTDLQNKAGVSREKLSLGVSSLQTAFTAVYGKVFTGKNVAKFALISIQMVAEAARFKYIEDQVINRGMYSSFEAGARITLLENNWSKISEQYHKSCKLGGGQFTEEEMKLGLLLYN
Research Area Others
Source Yeast
Protein Names Recommended name: Ribosome-inactivating protein lychnin EC= 3.2.2.22
Expression Region 1-234aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 28.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells. Inhibits cell-free translation in rabbit reticulocyte lysate system with an IC(50) of 0.17 nM.
Protein Families Ribosome-inactivating protein family, Type 1 RIP subfamily

Related Products

Antibodies

Antibodies for Silene chalcedonica

Proteins

Proteins for Silene chalcedonica (Maltese-cross) (Lychnis chalcedonica)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.