Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
clfA; SAS0752; Clumping factor A; Fibrinogen receptor A; Fibrinogen-binding protein A
Species
Staphylococcus aureus (strain MSSA476)
Expression Region
228-558aa
Target Protein Sequence
GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression of recombinant Staphylococcus aureus clfA protein includes the construction of the expression vector containing the recombinant DNA and the transformation of the expression vector into the E.coli, which provides a variety of macromolecules and components required for transcription and translation. The recombinant DNA encodes the 228-558aa of the Staphylococcus aureus clfA protein. This N-terminal 6xHis-tagged recombinant Staphylococcus aureus clfA protein is also characterized by high purity, >90%. Under SDS-PAGE condition, this recombinant clfA protein migrated to the band of about 36 kDa molecular weight.
ClfA is a virulence factor from Staphylococcus aureus. As a virulence factor, ClfA is an important virulence factor that promotes the pathogenesis of the diseases and can be a target for generation of vaccine
against S. aureus infections. As the targeted protein is highly antigenic and conserved, hence the designed novel vaccine construct holds potential against emerging multi-drug-resistant organisms. Genetic elimination of the binding motif on fibrinogen for the S. aureus virulence factor ClfA improves host survival in septicemia. B. There are many distinct virulence factors related to the disease establishment. In Staphylococcus spp. factors such as the fibronectin-binding proteins (fnbA and fnbB), elastin binding proteins (ebpS), clumping factors (clfA and clfB), and collagen-binding protein (cna) play important roles in binding to host cells, colonization, and invasion. Sortase A is an essential virulence factor of S. aureus, which is responsible for the determinants, which can escape host immune response and cause a series of diseases. SrtA mediates anchoring of several adhesion-related proteins, such as ClfA/ClfB.