Recombinant Staphylococcus aureus Clumping factor A(clfA),partial

In Stock
Code CSB-EP753416SKWe1
Product Type Recombinant Protein
Size US$2632Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q6GB45
Lead Time 3-7 business days
Relevance Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Fibrinogen receptor A Fibrinogen-binding protein A
Species Staphylococcus aureus (strain MSSA476)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE
Source E.coli
Gene Names clfA
Expression Region 228-558aa
Tag Info Tag-Free
Mol. Weight 36.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps (By similarity).
Subcellular Location Secreted, cell wall, Peptidoglycan-anchor
Protein Families Serine-aspartate repeat-containing protein (SDr) family
Database Links

KEGG: sas:SAS0752

Related Products

clfA Antibodies

clfA Antibodies for Staphylococcus aureus (strain MSSA476)

clfA Proteins

clfA Proteins for Staphylococcus aureus (strain MSSA476)

clfA Proteins for Staphylococcus aureus

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.