Recombinant Staphylococcus aureus Enterotoxin type B (entB)

In Stock
Code CSB-YP360703FKZ
Abbreviation Recombinant Staphylococcus aureus entB protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
entB
Uniprot No.
Research Area
others
Alternative Names
entBEnterotoxin type B; SEB
Species
Staphylococcus aureus
Source
Yeast
Expression Region
28-266aa
Target Protein Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Full-length of mature Staphylococcus aureus Enterotoxin type B (entB) cDNA carrying an N-terminal 6xHis-tag was expressed in the yeast cells. The resulting protein is the recombinant fusion protein consisting of 28-266aa of Staphylococcus aureus entB. The SDS-PAGE showed an about 28-33 kDa molecular mass of this protein and determined its purity of over 90%. In-stock entB proteins are offered now. In addition to producing specific anti-entB antibodies, this recombinant entB protein may also find uses in the microbiology.

Staphylococcus aureus-secreted exotoxin entB is one of the most potent bacterial superantigens (SAgs) that exerts toxic effects upon the immune system, inducing cytokine release and eliciting inflammation. EntB mainly targets T-cell receptors (TCRs) on the T cells and major histocompatibility complex (MHC) class II molecules on Ag-presenting cells (APCs), forming a ternary complex between specific Vβ chains and MHC class II molecules through cross-link. It is water-soluble, heat unstable, and resistant to the proteolytic enzyme, including trypsin, papain, and pepsin. And it also possesses emetic activity. EntB can cause multi-organ system failure and death at low concentrations. The involvement of entB in the pathogenesis of some diseases such as atopic dermatitis, asthma, and chronic rhinitis, has been documented.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Antigen

Review: When a target antigen (SEB) is present (10 ng/mL), a cluster of HGNs was observed in the paper fiber pores.

By Anonymous

 Q&A
Q:

Does your enterotoxin type B from staph aureus have verified biological superantigen activity?

A:

Sorry, this protein haven't verified biological superantigen activity.

Target Background

Function
Staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility (MHC) complex class II and T-cell receptor (TCR) molecules. In turn, this ternary complex activates a large number of T-lymphocytes initiating a systemic release of proinflammatory cytokines. Causes also the intoxication staphylococcal food poisoning syndrome.
Subcellular Location
Secreted.
Protein Families
Staphylococcal/streptococcal toxin family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*