Recombinant Staphylococcus aureus Enterotoxin type B (entB)

In Stock
Code CSB-EP360703FKZ
Abbreviation Recombinant Staphylococcus aureus entB protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP360703FKZ could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus entB.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP360703FKZ could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus entB.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
entB
Uniprot No.
Research Area
Others
Alternative Names
entBEnterotoxin type B; SEB
Species
Staphylococcus aureus
Source
E.coli
Expression Region
28-266aa
Target Protein Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Staphylococcus aureus Enterotoxin type B (entB) is produced using an E.coli expression system and covers the complete mature protein sequence from amino acids 28 to 266. The protein comes with an N-terminal GST tag attached to help with purification and detection processes. SDS-PAGE analysis shows the purity exceeds 90%, which appears to make it suitable for different research purposes.

Staphylococcus aureus Enterotoxin type B (entB) is a powerful exotoxin that plays a key role in how this bacterium causes disease. It works as a superantigen, causing widespread T-cell activation and triggering the release of cytokines. This protein has become important for researchers studying immune responses, how microbes cause disease, and developing new treatments. Learning how entB works may help advance therapies for diseases caused by bacterial toxins.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The Staphylococcus aureus entB is a superantigen that requires precise tertiary structure formation, including specific disulfide bonds, for its biological activity (e.g., MHC class II binding and T-cell activation). While the GST tag may enhance solubility, its large size (≈26 kDa) may sterically hinder proper folding of the enterotoxin domain (≈28 kDa). E. coli can express soluble proteins but may not replicate the exact folding environment needed for this bacterial toxin. Without experimental validation, the protein cannot be assumed to be correctly folded or bioactive. The high purity indicates low impurities, but does not guarantee native conformation.

1. Antibody Development and Validation Studies

This application is generally suitable. The recombinant entB can serve as an immunogen for antibody production, as antibodies often recognize linear epitopes. The GST tag facilitates purification. However, antibodies generated may not recognize conformational epitopes of the native, properly folded enterotoxin B. Validate antibody specificity against native enterotoxin B (e.g., from S. aureus culture supernatant) for reliable detection.

2. GST Pull-Down Assays for Protein-Protein Interactions

Use with caution. While the GST tag enables pull-down assays, misfolding may alter physiological interactions (e.g., with MHC class II or T-cell receptors). The tag itself may cause non-specific binding. Any identified interactions must be validated using tag-free, native enterotoxin B to ensure biological relevance. Consider cleaving the GST tag before assays.

3. Biochemical Characterization and Stability Studies

Suitable for basic biophysical analyses (e.g., circular dichroism for secondary structure, dynamic light scattering for aggregation). However, data may not reflect native entB due to the GST tag's influence. For stability studies, focus on the tagged protein's properties rather than extrapolating to the native toxin.

4. ELISA Development and Immunoassay Optimization

Feasible for research assays, but the GST tag may interfere with antigen-antibody binding if epitopes are masked. If developing diagnostic assays, compare sensitivity/specificity with native entB. The high purity supports consistency, but ensures the recombinant protein's reactivity mirrors native toxin behavior when using clinical samples.

Final Recommendation & Action Plan

Before using this recombinant entB for functional studies, validate its folding and activity. First, assess structural integrity via circular dichroism (compare spectrum to native entB if available) and check disulfide bond formation via non-reducing SDS-PAGE. For bioactivity, perform a functional assay (e.g., T-cell proliferation or MHC binding assay). If inactive, consider tag removal (GST cleavage) and re-test. For antibody production, proceed but validate antibodies against the native toxin. Avoid interaction or immunoassay studies without confirming the protein's native-like conformation. For reliable results, express tag-free entB in a suitable system (e.g., E. coli with optimized disulfide bond formation) or use native toxin as a control.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Can you please confirm if the concentration is 3mg/ml ?
Also, can you please provide the volume for this product?.

A:
Thanks for your inquiry. I have confirmed with our post process department. The concentration of CSB-EP360703FKZ is 3mg/ml, and the volume of each vial is 0.34ml, and the total Qty is 3 vials. (3mg/ml* 0.34ml* 3 vials)

Target Background

Function
Staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility (MHC) complex class II and T-cell receptor (TCR) molecules. In turn, this ternary complex activates a large number of T-lymphocytes initiating a systemic release of proinflammatory cytokines. Causes also the intoxication staphylococcal food poisoning syndrome.
Subcellular Location
Secreted.
Protein Families
Staphylococcal/streptococcal toxin family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*