Recombinant Staphylococcus aureus ESAT-6 secretion system extracellular protein A (esxA)

In Stock
Code CSB-EP763968SKW
Abbreviation Recombinant Staphylococcus aureus esxA protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
esxA
Uniprot No.
Research Area
Others
Alternative Names
esxA; SAS0258Type VII secretion system extracellular protein A; Ess extracellular protein A
Species
Staphylococcus aureus (strain MSSA476)
Source
E.coli
Expression Region
1-97aa
Target Protein Sequence
MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.0kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Staphylococcus aureus ESAT-6 secretion system extracellular protein A (esxA) is produced in E.coli and contains the complete sequence from amino acids 1 to 97. The protein features an N-terminal 6xHis-SUMO tag, which aids in purification and detection processes. SDS-PAGE analysis indicates a purity level exceeding 90%, making this product suitable for research applications. Low endotoxin levels during preparation appear to ensure compatibility with most experimental setups.

The ESAT-6 secretion system extracellular protein A (esxA) represents a key component of the Staphylococcus aureus secretion machinery. This protein likely plays a significant role in transporting and secreting proteins across the bacterial membrane—a process that seems essential for bacterial virulence and survival. Research into this protein may prove vital for understanding bacterial pathogenicity and could contribute to developing new antibacterial strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Immunological Studies

This recombinant esxA protein appears well-suited as an immunogen for generating polyclonal or monoclonal antibodies specific to Staphylococcus aureus ESAT-6 secretion system components. The N-terminal 6xHis-SUMO tag makes purification and immobilization straightforward for antibody screening assays. Such antibodies might serve as valuable research tools for studying esxA expression, localization, and secretion in S. aureus cultures. The >90% purity level should be sufficient for immunization protocols and subsequent antibody characterization experiments.

2. Protein-Protein Interaction Studies

Researchers can use the recombinant esxA protein in pull-down assays to identify potential binding partners within the ESAT-6 secretion system or other S. aureus proteins. The N-terminal His-tag allows for immobilization on nickel-affinity resins, which may help capture interacting proteins from S. aureus lysates. Co-immunoprecipitation experiments using anti-His antibodies could also be performed to study esxA interactions in reconstituted protein systems. These approaches might contribute to understanding the molecular mechanisms behind the ESAT-6 secretion pathway in staphylococci.

3. Biochemical Characterization and Stability Studies

This purified esxA protein can undergo various biochemical analyses including size exclusion chromatography, dynamic light scattering, and thermal stability assays to characterize its oligomerization state and biophysical properties. Researchers might use the protein to determine optimal storage conditions, pH stability ranges, and temperature tolerance for future experimental work. Proteolytic sensitivity assays could also help map potential cleavage sites and reveal protein stability under different buffer conditions.

4. ELISA-Based Detection System Development

The recombinant esxA protein may serve as a standard or coating antigen for developing enzyme-linked immunosorbent assays (ELISA) to detect esxA in S. aureus culture supernatants or cell lysates. The His-SUMO tag permits oriented immobilization on ELISA plates using anti-His antibodies, potentially improving assay sensitivity and reproducibility. This application could prove valuable for research studying esxA secretion kinetics, expression regulation, or comparative analysis across different S. aureus strains.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Virulence factor that is important for the establishment of infection in the host. EsxA is required for EsxB synthesis as well as secretion. Modulates host cell apoptotic pathways and mediates together with EsxB the release of S.aureus from the host cell. By acting on apoptosis, plays a role in the modulation of dendritic cell-mediated immunity.
Subcellular Location
Secreted.
Protein Families
WXG100 family, sagEsxA-like subfamily
Database Links

KEGG: sas:SAS0258

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*