Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
sso7d; sso7d-1; SSO10610DNA-binding protein 7d; 7 kDa DNA-binding protein d; Sso7d
Species
Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Target Protein Sequence
ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Sulfolobus solfataricus sso7d contains amino acids 2-64. The theoretical molecular weight of the sso7d protein is 23.1 kDa. This sso7d protein is produced using e.coli expression system. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of sso7d, which enables a simple process of detecting and purifying the sso7d recombinant protein in the following steps.
Sulfolobus solfataricus DNA-binding protein 7d (Sso7d) is a small, highly basic protein that plays a role in DNA compaction and organization within the archaeal cell. Sso7d has a unique structural feature known as an oligo-arginine "arm" that extends from its core structure. This arm is responsible for the strong electrostatic interactions with the negatively charged phosphate backbone of DNA, facilitating the binding of Sso7d to DNA. Research on Sso7d has contributed to the understanding of archaeal chromatin structure and the mechanisms by which Sulfolobus solfataricus adapts to its harsh environments. Additionally, the DNA-binding properties of Sso7d have made it a valuable tool in biotechnological applications, such as a DNA-stabilizing agent in polymerase chain reaction (PCR) and DNA storage.
