Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d)

In Stock
Code CSB-EP334566FPM
Abbreviation Recombinant Sulfolobus solfataricus sso7d protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
sso7d
Uniprot No.
Research Area
Others
Alternative Names
sso7d; sso7d-1; SSO10610DNA-binding protein 7d; 7 kDa DNA-binding protein d; Sso7d
Species
Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Source
E.coli
Expression Region
2-64aa
Target Protein Sequence
ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Sulfolobus solfataricus sso7d contains amino acids 2-64. The theoretical molecular weight of the sso7d protein is 23.1 kDa. This sso7d protein is produced using e.coli expression system. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of sso7d, which enables a simple process of detecting and purifying the sso7d recombinant protein in the following steps.

Sulfolobus solfataricus DNA-binding protein 7d (Sso7d) is a small, highly basic protein that plays a role in DNA compaction and organization within the archaeal cell. Sso7d has a unique structural feature known as an oligo-arginine "arm" that extends from its core structure. This arm is responsible for the strong electrostatic interactions with the negatively charged phosphate backbone of DNA, facilitating the binding of Sso7d to DNA. Research on Sso7d has contributed to the understanding of archaeal chromatin structure and the mechanisms by which Sulfolobus solfataricus adapts to its harsh environments. Additionally, the DNA-binding properties of Sso7d have made it a valuable tool in biotechnological applications, such as a DNA-stabilizing agent in polymerase chain reaction (PCR) and DNA storage.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc.
Subcellular Location
Cytoplasm.
Protein Families
7 kDa DNA-binding/endoribonuclease P2 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*