Recombinant Toxocara canis 26 kDa secreted antigen (TES-26)

In Stock
Code CSB-YP347478THA
Abbreviation Recombinant Toxocara canis TES-26 protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP347478THA could indicate that this peptide derived from Yeast-expressed Toxocara canis (Canine roundworm) TES-26.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP347478THA could indicate that this peptide derived from Yeast-expressed Toxocara canis (Canine roundworm) TES-26.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TES-26
Uniprot No.
Research Area
Others
Alternative Names
TES-2626 kDa secreted antigen; Toxocara excretory-secretory antigen 26; TES-26
Species
Toxocara canis (Canine roundworm)
Source
Yeast
Expression Region
22-262aa
Target Protein Sequence
QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The 26 kDa secreted antigen, also known as TES-26, is a significant component in the excretory-secretory products of various helminths. This antigen has been identified in parasites such as Toxocara, Fasciola hepatica, Schistosoma, and Clonorchis sinensis. In Toxocara, the 26 kDa antigen is deglycosylated, enhancing the specificity of serodiagnosis for human toxocariasis [1]. Similarly, in Fasciola hepatica, understanding the biochemical characteristics and localization of the 26-28 kDa coproantigen is crucial for developing improved immunodiagnostic assays [2]. Moreover, in Schistosoma, the 26 kDa antigen has been shown to induce a protective immune IgE response in rats [3]. In Clonorchis sinensis, the 26 kDa band is a major protein in the excretory-secretory antigen [4].

The 26 kDa antigen is part of a group of antigens with molecular masses ranging from 26 to 38 kDa that have been investigated for their immunodominant properties in various infections [5]. These antigens are crucial for the immune response and have been associated with specific antibody reactions in diseases caused by parasites like Toxoplasma gondii [6], Strongyloides stercoralis [7], and Taenia solium [8]. Additionally, the 26 kDa antigen has been implicated in sparganosis, where it is identified as chymase and its degradation products [9].

References:
[1] W. Roldán, G. Elefant, & A. Ferreira, "Deglycosylation of toxocara excretory–secretory antigens improves the specificity of the serodiagnosis for human toxocariasis", Parasite Immunology, vol. 37, no. 11, p. 557-567, 2015. https://doi.org/10.1111/pim.12248
[2] S. Abdel-Rahman, O. Kl, & M. Jb, "Biochemical characterization and localization of fasciola hepatica 26‐28 kda diagnostic coproantigen", Parasite Immunology, vol. 21, no. 6, p. 279-286, 1999. https://doi.org/10.1046/j.1365-3024.1999.00191.x
[3] M. Damonneville, C. Auriault, T. Thorel, C. Verwaerde, A. Pierce, G. Streckeret al., "Induction of a protective immune ige response in rats by injection of defined antigens of schistosomulum-released products: immunochemical properties of the target antigens", International Archives of Allergy and Immunology, vol. 79, no. 3, p. 320-328, 1986. https://doi.org/10.1159/000233994
[4] M. Choi, J. Ryu, M. Lee, S. Li, B. Chung, J. Chaiet al., "Specific and common antigens of clonorchis sinensis and opisthorchis viverrini (opisthorchidae, trematoda)", The Korean Journal of Parasitology, vol. 41, no. 3, p. 155, 2003. https://doi.org/10.3347/kjp.2003.41.3.155
[5] P. Andersen, D. Askgaard, A. Gottschau, J. Bennedsen, S. Nagai, & I. Heron, "Identification of immunodominant antigens during infection with mycobacterium tuberculosis", Scandinavian Journal of Immunology, vol. 36, no. 6, p. 823-831, 1992. https://doi.org/10.1111/j.1365-3083.1992.tb03144.x
[6] O. Emelia, Z. Mohamed, O. Sulaiman, M. Rohela, G. Saadatnia, Y. Chenet al., "An assay for selection of sera with circulatingtoxoplasma gondiiantigens", Journal of Immunoassay and Immunochemistry, vol. 31, no. 1, p. 79-91, 2009. https://doi.org/10.1080/15321810903405134
[7] R. Rodpai, P. Intapan, T. Thanchomnang, O. Sanpool, P. Janwan, P. Laummaunwaiet al., "Strongyloides stercoralis diagnostic polypeptides for human strongyloidiasis and their proteomic analysis", Parasitology Research, vol. 115, no. 10, p. 4007-4012, 2016. https://doi.org/10.1007/s00436-016-5170-7
[8] R. Rodríguez-Canul, J. Allan, C. Fletes, I. Sutisna, I. Kapti, & P. Craig, "Comparative evaluation of purified taenia solium glycoproteins and crude metacestode extracts by immunoblotting for the serodiagnosis of human t. solium cysticercosis", Clinical and Diagnostic Laboratory Immunology, vol. 4, no. 5, p. 579-582, 1997. https://doi.org/10.1128/cdli.4.5.579-582.1997
[9] Y. Chung, Y. Kong, H. Yang, & S. Cho, "Igg antibody responses in early experimental sparganosis and igg subclass responses in human sparganosis", The Korean Journal of Parasitology, vol. 38, no. 3, p. 145, 2000. https://doi.org/10.3347/kjp.2000.38.3.145

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds phosphatidylethanolamine.
Subcellular Location
Secreted.
Protein Families
Phosphatidylethanolamine-binding protein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*