Recombinant Toxocara canis 26 kDa secreted antigen(TES-26)

Code CSB-BP347478THA
Product Type Recombinant Protein
Size US$294
Uniprot No. P54190
Relevance Binds phosphatidylethanolamine.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Toxocara excretory-secretory antigen 26 Short name: TES-26
Species Toxocara canis (Canine roundworm)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Research Area Others
Source Baculovirus
Gene Names TES-26
Protein Names Toxocara excretory-secretory antigen 26Short name:TES-26
Expression Region 22-262aa
Tag Info C-terminal 9xHis-tagged
Mol. Weight 27.9 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds phosphatidylethanolamine.
Subcellular Location Secreted
Protein Families Phosphatidylethanolamine-binding protein family

Related Products

TES-26 Antibodies

TES-26 Antibodies for Toxocara canis (Canine roundworm)

TES-26 Proteins

TES-26 Proteins for Toxocara canis (Canine roundworm)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.