Recombinant Toxocara canis 26 kDa secreted antigen (TES-26)

In Stock
Code CSB-EP347478THA
Abbreviation Recombinant Toxocara canis TES-26 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TES-26
Uniprot No.
Research Area
Others
Alternative Names
TES-2626 kDa secreted antigen; Toxocara excretory-secretory antigen 26; TES-26
Species
Toxocara canis (Canine roundworm)
Source
E.coli
Expression Region
22-262aa
Target Protein Sequence
QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Toxocara canis 26KDA secreted antigen (TES-26) is produced in E. coli and contains the full mature protein from amino acids 22 to 262. This protein carries an N-terminal 6xHis-SUMO tag, which appears to help with purification and detection. The product reaches a purity greater than 90% as verified by SDS-PAGE analysis, suggesting it meets high-quality standards for research applications.

TES-26 is a secreted antigen from Toxocara canis, the canine roundworm. In biological research, scientists study TES-26 for its potential role in host-parasite interactions, particularly in immune response mechanisms. As a secreted protein, it likely participates in modulating host immune systems, making it an interesting subject for parasitology and immunology studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Toxocara canis TES-26 antigen is expressed in E. coli, a prokaryotic system that is generally unsuitable for producing properly folded eukaryotic secretory proteins. TES-26 is a secreted antigen from a parasitic nematode that likely requires specific folding, disulfide bond formation, and potential glycosylation for its native structure and antigenic properties. While the protein is expressed as the mature form (22-262aa) with an N-terminal 6xHis-SUMO tag and >90% purity, E. coli lacks the eukaryotic chaperones and post-translational modification machinery necessary for correct folding of complex parasitic antigens. The SUMO tag may improve solubility, but cannot compensate for the lack of a proper eukaryotic folding environment. Since activity is unverified, the protein cannot be assumed to be correctly folded or to possess native antigenic properties without experimental validation.

1. Antibody Development and Validation Studies

The recombinant TES-26 can serve as an effective immunogen for generating antibodies that recognize linear epitopes, even if the protein is misfolded. The high purity and His-SUMO tag facilitate purification and screening. However, antibodies may not recognize conformational or glycosylation-dependent epitopes of native TES-26 from parasite secretions. Validation against native antigen from T. canis is recommended.

2. Protein-Protein Interaction Studies Using Tag-Assisted Pull-Down Assays

This application is high-risk without folding validation. While the tags enable technical feasibility for pull-down assays, if TES-26 is misfolded (as likely in E. coli), it will not interact physiologically with true host binding partners. Parasitic antigens require specific conformations for proper host protein interactions. Identified interactions could be non-physiological artifacts. This application should not be pursued without confirmation of proper folding.

3. Biochemical Characterization

Basic biochemical characterization is feasible with limitations. The TES-26 protein can be used for biophysical studies (size-exclusion chromatography, circular dichroism) to assess folding state. However, activity screening should be limited to validated functions of TES-26.

4. Immunological Response Studies in Animal Models

This application requires caution. If TES-26 is misfolded, it may not elicit immune responses representative of natural T. canis infection. The antigenic properties may differ significantly from the native TES-26 protein. This application should only be pursued after confirming proper folding and antigenic similarity to native TES-26.

Final Recommendation & Action Plan

Given the high probability of misfolding in E. coli for this eukaryotic parasitic antigen, recommend first performing comprehensive validation: 1) Biophysical characterization (circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state); 2) Immunological validation comparing antibody reactivity with native TES-26 from T. canis secretions; 3) Structural validation if possible. Antibody development can proceed as the safest application. Avoid all functional studies (interactions, immunological models) until proper folding and antigenic properties are confirmed. For reliable TES-26 research, obtain native antigen from parasite sources or use eukaryotic expression systems for recombinant production.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds phosphatidylethanolamine.
Subcellular Location
Secreted.
Protein Families
Phosphatidylethanolamine-binding protein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*