Recombinant Vaccinia virus IMV heparin binding surface protein (H3L), partial

In Stock
Code CSB-EP3210GKL1
Abbreviation Recombinant Vaccinia virus H3L protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
others
Species
Vaccinia virus
Source
E.coli
Expression Region
21-270aa
Target Protein Sequence
TFPNVHEHINDQKFDDVKDNEVMPEKRNVVVVKDDPDHYKDYAFIQWTGGNIRNDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSNFFTELENKKVEYVVIVENDNVIEDITFLRPVLKAMHDKKIDILQMREIITGNKVKTELVMDKNHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQILDNAAKYVEHDPRLVAEHRFENMKPNFWSRIGTAAAKRYPG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.6 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Vaccinia virus IMV heparin-binding surface protein (H3L) is expressed in E. coli and includes the amino acid region 21-270. This partial-length protein is engineered with an N-terminal 10xHis-tag and a C-terminal Myc-tag for easier purification and detection. The protein achieves a purity greater than 85%, as confirmed by SDS-PAGE analysis, which appears sufficient for most research applications.

The Vaccinia virus IMV heparin-binding surface protein (H3L) plays a critical role in how the virus interacts with host cells, particularly through its binding affinity to heparin. This interaction seems vital for understanding viral entry and pathogenesis. H3L has become an important focus in virology research, likely providing insights into viral mechanisms and potential therapeutic targets.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Vaccinia virus H3L is a viral envelope protein that requires precise folding, disulfide bond formation, and proper tertiary structure for its heparin-binding activity and viral entry functions. The E. coli expression system cannot provide the eukaryotic post-translational modifications and complex folding environment necessary for this viral surface protein. The dual N-terminal 10xHis-tag and C-terminal Myc-tag may sterically interfere with the protein's functional domains and binding sites. While the protein may be soluble, it is highly unlikely to achieve the correct folding needed for functional heparin-binding activity. The probability of correct folding with biological activity is low.

1. Antibody Development and Immunoassay Research

Antibody development relies on antigenic sequence recognition rather than functional folding. This recombinant H3L serves as an excellent immunogen for generating antibodies against linear epitopes of the vaccinia virus surface protein. The dual tags facilitate purification and provide additional epitopes for screening. However, antibodies may not efficiently recognize conformational epitopes on the native, properly folded viral protein.

2. Biochemical Characterization and Binding Assays

Basic biophysical characterization is possible, but functional binding studies are not feasible. Functional binding activity requires native protein conformation that E. coli cannot provide. Techniques like circular dichroism can analyze secondary structure, but heparin-binding assays will likely yield negative results due to probable misfolding.

3. Tag-Assisted Purification Method Development

Purification development depends on tag functionality rather than protein folding. This protein is ideal for developing and optimizing dual-tag purification protocols. The tags provide flexibility for testing different purification strategies and comparing tag efficiency.

Final Recommendation & Action Plan

The E. coli expression system is fundamentally unsuitable for producing a functional viral surface protein like H3L, limiting applications to non-functional uses. The immediate priority is basic biophysical characterization to assess the protein's physical properties. Applications 1 and 3 (antibody development and purification optimization) can proceed immediately. Avoid interaction studies and functional research due to the high probability of misfolding. For functional H3L studies, use mammalian or insect cell expression systems that can provide proper post-translational modifications and folding environment. 

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*