Recombinant Vaccinia virus Protein K3 (VACWR034)

In Stock
Code CSB-YP323585VAI
Abbreviation Recombinant Vaccinia virus VACWR034 protein
MSDS
Size $436
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
VACWR034
Uniprot No.
Research Area
Others
Alternative Names
VACWR034; K2L; K3L; Protein K3; Protein K2
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Source
Yeast
Expression Region
1-88aa
Target Protein Sequence
MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.6kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Vaccinia virus Protein K3 (VACWR034) is manufactured using a yeast expression system. The protein spans the complete sequence from amino acids 1 to 88. An N-terminal 6xHis-tag is attached, which makes purification and detection more straightforward. SDS-PAGE analysis confirms the purity exceeds 90%. This product is intended strictly for research purposes and appears to deliver consistent results across different experimental conditions.

Protein K3 from vaccinia virus seems to play a key role in how the virus manipulates host immune responses. The protein likely participates in pathways that disrupt the host's natural antiviral defenses, which is why it has become an important focus in virology and immunology studies. Learning more about how K3 functions may provide valuable insights into viral disease mechanisms and the complex interactions between pathogens and their hosts - knowledge that could prove essential for creating new treatments.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Vaccinia Virus Protein Interaction Studies

This recombinant K3 protein works well as either bait or target in pull-down experiments designed to find host cell proteins that interact with vaccinia virus during infection. The N-terminal 6xHis tag allows for straightforward attachment to nickel-affinity resins, making co-immunoprecipitation experiments with host cell lysates relatively simple. These types of studies might help researchers better understand the specific molecular processes that vaccinia virus uses to alter host cell behavior throughout its life cycle.

2. Antibody Development and Characterization

Researchers can use the purified K3 protein as an immunogen to create polyclonal or monoclonal antibodies that specifically recognize this vaccinia virus protein. The high purity level (over 90%) means there's minimal contamination that might cause unwanted cross-reactions with other proteins. Scientists would find these antibodies quite useful for investigating K3 protein expression patterns, cellular location, and biological function in vaccinia-infected cells using methods like Western blotting, immunofluorescence microscopy, and flow cytometry.

3. Biochemical and Biophysical Characterization

This recombinant protein offers a good starting point for in-depth biochemical studies of K3's inherent properties. Researchers can examine factors like heat stability, how the protein responds to different pH levels, and its overall structural features. Methods such as circular dichroism spectroscopy, dynamic light scattering, and analytical ultracentrifugation may help scientists understand how the protein folds, whether it forms complexes with itself, and how its shape changes under different conditions. The yeast expression system combined with His-tag purification should produce properly folded protein that's suitable for these types of detailed analyses.

4. Enzyme-Linked Immunosorbent Assays (ELISA)

The His-tagged K3 protein attaches easily to ELISA plates, making it possible to develop precise immunoassays for detecting anti-K3 antibodies in experimental samples. This approach proves particularly valuable when monitoring immune responses in laboratory animals exposed to vaccinia virus or when screening hybridoma cell culture supernatants during antibody production projects. The protein's high purity helps ensure that assays produce reliable, repeatable results with little background noise that could interfere with accurate measurements.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.
Gene References into Functions
  1. effects of the PKR mutations on pseudosubstrate vs. substrate interactions reflect differences between the rigid K3L protein and the plastic nature of eIF2alpha around the Ser-51 phosphorylation site. PMID: 18971339
Protein Families
Poxviridae K3 protein family
Database Links

KEGG: vg:3707649

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*