Recombinant Vaccinia virus Protein K3 (VACWR034)

In Stock
Code CSB-YP323585VAI
Abbreviation Recombinant Vaccinia virus VACWR034 protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
VACWR034
Uniprot No.
Research Area
Others
Alternative Names
VACWR034; K2L; K3L; Protein K3; Protein K2
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Source
Yeast
Expression Region
1-88aa
Target Protein Sequence
MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.6kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Vaccinia virus Protein K3 (VACWR034) is manufactured using a yeast expression system. The protein spans the complete sequence from amino acids 1 to 88. An N-terminal 6xHis-tag is attached, which makes purification and detection more straightforward. SDS-PAGE analysis confirms the purity exceeds 90%. This product is intended strictly for research purposes and appears to deliver consistent results across different experimental conditions.

Protein K3 from vaccinia virus seems to play a key role in how the virus manipulates host immune responses. The protein likely participates in pathways that disrupt the host's natural antiviral defenses, which is why it has become an important focus in virology and immunology studies. Learning more about how K3 functions may provide valuable insights into viral disease mechanisms and the complex interactions between pathogens and their hosts - knowledge that could prove essential for creating new treatments.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant Vaccinia virus Protein K3 (VACWR034) is produced in a yeast expression system as a full-length protein (1-88aa) with an N-terminal 6xHis-tag. Yeast expression systems provide eukaryotic folding machinery capable of supporting disulfide bond formation and some post-translational modifications, which may aid in proper folding for this viral protein. As a full-length protein, it has a reasonable probability of correct folding. However, viral proteins often have unique structural requirements that may not be fully replicated in heterologous systems, and the His-tag could potentially interfere with folding or function. Purity >90% by SDS-PAGE is determined under denaturing conditions and does not confirm native folding or bioactivity. No validation data (e.g., functional assays, circular dichroism) are provided. Therefore, while yeast expression increases the likelihood of correct folding, the protein's structural and functional integrity cannot be confirmed without experimental validation.

1. Vaccinia Virus Protein Interaction Studies

If correctly folded, the recombinant K3 protein can be used in pull-down assays to identify host cell interaction partners, as the His-tag facilitates immobilization. However, if misfolded, interaction domains may be altered, leading to non-specific binding or failure to recognize genuine biological partners, compromising the validity of viral-host interaction mechanisms studied.

2. Antibody Development and Characterization

This application is suitable as antibody generation primarily relies on linear epitope recognition, which is independent of folding status. The high purity and full-length sequence support consistent immunization and screening. However, if misfolded, antibodies may not optimally recognize conformational epitopes of the native K3 protein in biological contexts.

3. Biochemical and Biophysical Characterization

If properly folded, the protein is suitable for biophysical studies like circular dichroism or dynamic light scattering to analyze structure and stability. However, if misfolded, data would misrepresent the native protein's architecture, leading to incorrect conclusions about K3's properties.

4. ELISA Development

If correctly folded, the His-tagged K3 can be used as a coating antigen in ELISA for antibody detection. However, if misfolded, it may not present native epitopes accurately, resulting in unreliable assay results or false negatives in antibody screening.

Final Recommendation & Action Plan

This yeast-expressed full-length K3 protein may be correctly folded but requires validation before functional applications; the action plan includes: first confirming folding through biophysical methods (e.g., circular dichroism for secondary structure) and functional assays (e.g., interaction tests with known host proteins if available); if validation confirms proper folding, proceed with applications while noting potential tag interference; if misfolded, consider using alternative expression systems or tag-free protein; antibody development can proceed immediately but validate antibodies against native K3 in viral contexts; for ELISA and interaction studies, include controls like known interacting proteins or antibodies to ensure reliability. Always prioritize validation to avoid misleading results in viral protein research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.
Gene References into Functions
  1. effects of the PKR mutations on pseudosubstrate vs. substrate interactions reflect differences between the rigid K3L protein and the plastic nature of eIF2alpha around the Ser-51 phosphorylation site. PMID: 18971339
Protein Families
Poxviridae K3 protein family
Database Links

KEGG: vg:3707649

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*