Recombinant Vaccinia virus Protein K3 (VACWR034)

In Stock
Code CSB-EP323585VAI
Abbreviation Recombinant Vaccinia virus VACWR034 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
VACWR034
Uniprot No.
Alternative Names
VACWR034; K2L; K3L; Protein K3; Protein K2
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Source
E.coli
Expression Region
1-88aa
Target Protein Sequence
MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.6kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Vaccinia virus Protein K3 (VACWR034) comes from E. coli expression and includes an N-terminal 6xHis-SUMO tag that makes purification and detection straightforward. The complete protein spans amino acids 1-88 and shows purity levels above 90% when checked by SDS-PAGE analysis. This research-grade material appears optimized for experimental work where keeping endotoxin contamination low matters.

Vaccinia virus Protein K3 seems to play an important role in how the virus dodges host immune defenses. K3 likely disrupts the host's protein-making machinery, which may help the virus replicate and stick around longer. This makes it an interesting target for researchers studying viruses and immune responses. Learning how K3 works could reveal new details about how viruses cause disease and might point toward better antiviral treatments.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Vaccinia virus K3 protein is a viral host defense modulator that likely requires specific folding for its interactions with host proteins (e.g., PKR). The E. coli expression system may produce soluble protein, but it cannot replicate the eukaryotic cellular environment or post-translational modifications necessary for native folding and activity. The SUMO tag may improve solubility but could sterically hinder functional domains. While the full-length sequence (1-88aa) is present, the probability of correct folding and functional activity is moderate but uncertain without experimental validation.

1. Antibody Development and Immunological Studies

This recombinant K3 protein serves as an excellent immunogen for generating antibodies specific to vaccinia virus K3. The full-length sequence ensures comprehensive epitope coverage, and the high purity minimizes antibodies against contaminants. The His-SUMO tag facilitates purification and screening. These antibodies will be valuable for detecting K3 in viral infection studies via Western blot or ELISA.

2. Protein-Protein Interaction Studies

Protein-protein interactions depend on precise tertiary structure. The SUMO tag and uncertain folding state make this application high-risk without prior validation. If correctly folded, the protein could identify physiological partners like PKR. However, misfolding or steric interference from the SUMO tag may lead to non-specific binding (false positives) or failure to interact (false negatives). Data interpretation requires validation with native protein.

3. ELISA-Based Binding Assays

This protein is highly suitable as an antigen for ELISA assays to detect antibody binding or screen antibody specificity. However, for functional binding studies (e.g., with host proteins), the protein must be correctly folded and active, which is uncertain. As an immunoassay reagent, the protein's sequence and purity are key; functional binding assays require activity confirmation.

4. Biochemical Characterization and Stability Studies

This is the essential first step to assess protein quality. Techniques like size-exclusion chromatography (SEC) can determine oligomeric state, while circular dichroism (CD) can analyze secondary structure and thermal stability. These studies provide critical data on folding and stability of the protein itself, not the native protein.

Final Recommendation & Action Plan

The recombinant K3 protein is reliable for antibody development and biochemical characterization but requires validation for functional studies. The immediate priority is Application 4 (Biochemical Characterization) to assess folding quality via SEC and CD. If the protein shows monodisperse behavior and structured spectra, proceed to validate activity (e.g., PKR binding assay). Once activity is confirmed, Applications 2 and 3 (functional binding studies) can be attempted. Application 1 (Antibody Development) can proceed immediately. Without activity validation, limit use to immunoassays and avoid interaction studies. This systematic approach ensures reliable results.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.
Gene References into Functions
  1. effects of the PKR mutations on pseudosubstrate vs. substrate interactions reflect differences between the rigid K3L protein and the plastic nature of eIF2alpha around the Ser-51 phosphorylation site. PMID: 18971339
Protein Families
Poxviridae K3 protein family
Database Links

KEGG: vg:3707649

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*