Code | CSB-EP001921HU |
Abbreviation | Recombinant Human APOBEC3A protein |
MSDS | |
Size | $224 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
I am interested in purchasing the APOBEC3A recombinant protein (CSB-EP001921HU).I plan to use the protein in enzyme assays.
(1) Has this product been tested for enzyme activity? APOBEc3A is a cytidine deaminase enzyme.
(2) What is the location of the His-SUMO tag? N- or C-terminal? The tag is relatively large (>half the size of APOBEC3A), and it can potentially abolish the enzyme activity.
In case the product has not been tested for enzyme activity, what is the Cusabio policy regarding product return, in case we obtain the product and find that it has no activity?
MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDT
FVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN
Please kindly consult the shipment date of csb-ep001921hu. How long will it take? And can you provide the concentration of this protein?