Recombinant Human Glutamate carboxypeptidase 2 (FOLH1), partial

In Stock
Code CSB-EP008782HU
Abbreviation Recombinant Human FOLH1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP117294h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FOLH1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP117294h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FOLH1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Cell growth inhibiting protein 27 ; Cell growth-inhibiting gene 27 protein; FGCP; Folate hydrolase (prostate-specific membrane antigen) 1; Folate hydrolase 1; Folate hydrolase; Folate hydrolase prostate specific membrane antigen 1; FOLH 1; FOLH; Folh1; FOLH1_HUMAN; Folylpoly gamma glutamate carboxypeptidase; Folylpoly-gamma-glutamate carboxypeptidase; GCP 2; GCP II; GCP2; GCPII; GIG27; Glutamate carboxylase II; Glutamate carboxypeptidase 2; Glutamate carboxypeptidase II; Membrane glutamate carboxypeptidase; mGCP; N acetylated alpha linked acidic dipeptidase 1; N-acetylated-alpha-linked acidic dipeptidase I; NAALAD 1; NAALAD1; NAALAdase; NAALADase I; Prostate specific membrane antigen; Prostate specific membrane antigen variant F; Prostate-specific membrane antigen; PSM; PSMA; Pteroylpoly gamma glutamate carboxypeptidase; Pteroylpoly-gamma-glutamate carboxypeptidase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
48-750aa
Target Protein Sequence
EATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
83.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Our recombinant human FOLH1 protein is expressed in an E.coli system, providing a partial-length protein that contains the 48-750aa region. This protein features an N-terminal 6xHis-tag, facilitating easy purification and detection in your experiments. With a purity greater than 90% as determined by SDS-PAGE, this recombinant FOLH1 protein offers reliability and consistency for your research needs. Available in liquid or lyophilized powder forms, you can select the format that best meets your laboratory requirements.

FOLH1, also called GCP2, is a type II transmembrane protein that plays a crucial role in the central nervous system and prostate tissue. FOLH1 exhibits folate hydrolase and NAALAdase activity, which is essential for the hydrolysis of N-acetyl-aspartyl-glutamate (NAAG) into glutamate and N-acetyl-aspartate (NAA) [1][2]. The protein's enzymatic activity is vital for regulating excitatory neurotransmission, as it modulates the levels of glutamate, a key neurotransmitter involved in synaptic plasticity and cognitive functions [3]. Moreover, variations in the FOLH1 gene have been linked to metabolic disorders, such as hyperhomocysteinemia, which is associated with neural tube defects and other developmental issues [5]. Notably, FOLH1 is overexpressed in various cancers, particularly prostate cancer, making it a target for therapeutic interventions and imaging techniques [4][6][7].


References:
[1] F. Sedlák, Parallel metabolomics and lipidomics of a psma/gcpii deficient mouse model reveal alteration of naag levels and brain lipid composition, Acs Chemical Neuroscience, vol. 15, no. 7, p. 1342-1355, 2024. https://doi.org/10.1021/acschemneuro.3c00494
[2] Y. Li and P. Cozzi, Angiogenesis as a strategic target for prostate cancer therapy, Medicinal Research Reviews, vol. 30, no. 1, p. 23-66, 2009. https://doi.org/10.1002/med.20161
[3] X. Yao, J. Glessner, J. Li, X. Qi, X. Hou, C. Zhuet al., Integrative analysis of genome-wide association studies identifies novel loci associated with neuropsychiatric disorders, Translational Psychiatry, vol. 11, no. 1, 2021. https://doi.org/10.1038/s41398-020-01195-5
[4] A. Rizzo, S. Dall’Armellina, D. Pizzuto, G. Perotti, L. Zagaria, V. Lanniet al., Psma radioligand uptake as a biomarker of neoangiogenesis in solid tumours: diagnostic or theragnostic factor? Cancers, vol. 14, no. 16, p. 4039, 2022. https://doi.org/10.3390/cancers14164039
[5] J. Guo, H. Xie, J. Wang, H. Zhao, F. Wang, C. Liuet al., The maternal folate hydrolase gene polymorphism is associated with neural tube defects in a high-risk chinese population, Genes & Nutrition, vol. 8, no. 2, p. 191-197, 2012. https://doi.org/10.1007/s12263-012-0309-3
https://doi.org/10.1007/s12032-020-01427-0
[6] T. Jeitner, J. Babich, & J. Kelly, Advances in psma theranostics, Translational Oncology, vol. 22, p. 101450, 2022. https://doi.org/10.1016/j.tranon.2022.101450
[7] A. Adnan and S. Basu, Psma receptor-based pet-ct: the basics and current status in clinical and research applications, Diagnostics, vol. 13, no. 1, p. 158, 2023. https://doi.org/10.3390/diagnostics13010158

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Involved in prostate tumor progression.; Also exhibits a dipeptidyl-peptidase IV type activity. In vitro, cleaves Gly-Pro-AMC.
Gene References into Functions
  1. PSMA, TERT, and PDEF may serve as a reference for clinical diagnosis and as potential targets for the malignant tumor of the prostate therapeutics PMID: 28829509
  2. Furthermore, the results also demonstrate that the stability of GCPII protein is regulated by HDAC1 through acetylation at the lysine 479 residue. PMID: 29448109
  3. Results provide evidence that PSMA is expressed in the neovasculature of a subset of soft tissue tumors to a variable extent predominantly occurring in sarcomas. PMID: 28002805
  4. PSMA is significantly overexpressed in the neovasculature of differentiated thyroid cancers compared with normal and benign thyroid nodules PMID: 28844117
  5. Demonstrate that several laminin-derived peptides containing carboxy-terminal glutamate moieties (LQE, IEE, LNE) are bona fide substrates for PSMA. Subsequently, the peptide products were tested for their effects on angiogenesis in various models. PMID: 27387982
  6. results demonstrate both the feasibility of preparing PSMA-targeted MBs and the benefits of using bioorthogonal chemistry to create targeted US probes PMID: 28472168
  7. Xenografted human tumors expressing different levels of prostate-specific membrane antigen (PSMA) was produced to assess the clearance, biodistribution and imaging potential of 123I-scFvD2B. PMID: 28051996
  8. GCPII may not be a priority target for molecular imaging of atherosclerotic lesions. PMID: 27609368
  9. We also confirmed the specificity and selectivity of prostate-specific membrane antigen targeting by assessing prostate-specific membrane antigen-null PC3 cell lines under the same conditions (<10% cell ablation PMID: 28351335
  10. In conclusion, we have successfully developed the specific PSMA-targeting IO nanoparticle, DOTA-IO-GUL, as a dual-modality probe for complementary PET/MR imaging PMID: 26739097
  11. The risk of coronary disease and ischemic stroke associated with multiple polymorphisms and haplotypes of MADD and FOLH1 in Han Chinese patients are reported in association with alcohol consumption. PMID: 27070640
  12. MDM2 and PSMA may co-regulate the expression of certain MMPs and, thus, the functionality of cells in metastatic breast cancer. PMID: 26977010
  13. Systemic treatment with these radiation-sensitizing agents selectively enhanced the potency of external beam radiation therapy for established PSMA-positive tumors. PMID: 26438155
  14. prostate-specific membrane antigen is significantly overexpressed in adrenocortical carcinoma neovasculature when compared with normal and benign adrenal tumors PMID: 26771706
  15. Data show that the expressed antibody could specifically bind to prostate-specific membrane antigen ( PSMA) positive cells. PMID: 27358992
  16. Ad5/35E1aPSESE4 is effective in marking PSA/PSMA-positive prostate cancer cells in patient blood to improve the efficacy of utilizing CTCs as a biomarker. PMID: 26723876
  17. evaluated the relaxometric properties of these agents in solution, in prostate cancer cells, and in an in vivo experimental model to demonstrate the feasibility of PSMA-based MR molecular imaging PMID: 26212031
  18. First evidence of PSMA expression in differentiated thyroid cancer using [Ga]PSMA-HBED-CC PET/CT. PMID: 25916744
  19. In vitro immunotherapy is described for anti-prostate cancer effects of cytotoxic T lymphocytes induction by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells. PMID: 26125931
  20. Results from genetic models highlight the importance of GCPII genetic variants as relatively novel risk factors for breast cancer and prostate cancer. PMID: 26471812
  21. The findings suggest that C1561T-GCPII variation may be associated with risk for adenomatous polyp, and vitamin C may modify risk by interacting with the variant gene, its expression product and/or folate substrates. PMID: 26028103
  22. This study demonstrates the feasibility of D2B IgG, F(ab')2 and Fab fragments for targeting PSMA-expressing prostate cancer xenografts. PMID: 24764162
  23. This study demonstrated that Overexpression and Nucleolar Localization gcp2 in glioblastoma. PMID: 26079448
  24. we focus on the susceptibilities of these PSA-PSMA prostate clones to factors that promote prostate hyperplastic, neoplastic and metastatic development PMID: 24788382
  25. PSMA expression may be correlated with nanog's expression as well as with other confounders in a population of prostate CSCs. PMID: 24762500
  26. High glutamate carboxypeptidase II levels are associated with pancreatic cancer. PMID: 24477651
  27. High tumor PSMA expression was not an independent predictor of lethal prostate cancer in the current study. PMID: 24130224
  28. Taken together, this study demonstrated that the increase in GCPII induced by VPA is not due to the classical epigenetic mechanism, but via enhanced acetylation of lysine residues in GCPII. PMID: 24939622
  29. our data may suggest a new role for PSMA in prostate cancer progression, and provide opportunities for developing non-invasive approaches for diagnosis or prognosis of prostate cancer PMID: 24424840
  30. Tumor-associated vasculature was PSMA-positive in 74% of primary breast cancers and in 100% of breast cancers metastatic to brain. PSMA was not detected in normal breast tissue. No significant association was seen between PSMA and lymph node involvement. PMID: 24304465
  31. the impact of Glutamate carboxypeptidase II (GCPII) haplotypes on the expression of PSMA, BNIP3, Ec-SOD, GSTP1 and RASSF1 genes were elucidated to understand the epigenetic basis of oxidative stress and prostate cancer risk. PMID: 23979608
  32. PSMA is part of a proteolytic cascade where it acts downstream of MMP-2 to create small pro-angiogenic laminin peptides. PMID: 23775497
  33. The increase in gene expression ratio of PSA:PSMA to about 4.95 strongly correlated with the prostate cancer and with high intratumoral angiogenesis. PMID: 24063616
  34. High glutamate carboxypeptidase II mRNA expression is associated with pelvic lymph node micrometastasis in prostate cancer. PMID: 24292502
  35. Data suggest the importance of an aromatic group and succinimide moiety for high affinity of probes with prostate-specific membrane antigen (PSMA) PMID: 24063417
  36. Taking into account the PC phenotypes according to RKIP among PSA-PSMA profiles may improve distinguishing them from cancers that will become more aggressive. PMID: 23991415
  37. Data suggest the radioimmunoscintigraphic detection of radiolabeled prostate specific membrane antigen (PSMA antibodies might not be entirely specific for prostatic cells PMID: 21640619
  38. Data indicate that PSA, PSMA, hK2, PSCA, DD3, and their combinations, combined analysis of PSA and/or hK2 expression in pelvic lymph nodes could predict biochemical recurrence free survival (BRFS) following radical prostatectomy (RP). PMID: 21600799
  39. These data suggest that GCPII has two distinctive binding sites for two different substrates and that ABETA degradation occurs through binding to S1 pocket of GCPII. PMID: 23891752
  40. Data indicate that glutamate carboxypeptidase II (GCPII) is not an amyloid peptide-degrading enzyme. PMID: 23525278
  41. Data did not show any amyloid-beta (Abeta) peptide degradation activity of glutamate carboxypeptidase II (GCPII). PMID: 23525279
  42. Folate plus vitamin B12 supplementation can improve negative symptoms of schizophrenia, but treatment response is influenced by FOLH1 genetic variation in folate absorption. PMID: 23467813
  43. PSMA could be used as an independent prognostic marker for the osteosarcoma patients PMID: 22009216
  44. Canine PSMA reveals similar characteristics to human PSMA rendering this protein useful as a translational model for investigations of prostate cancer as well as a suitable antigen for targeted therapy studies in dogs. PMID: 23359458
  45. androgen-deprivation induced a decrease in AR and PSMA levels in androgen-sensitive LNCaP cells, which may be associated with the development of more aggressive disease-state following androgen deprivation therapy. PMID: 23041906
  46. The D191V variant increases breast cancer risk by affecting plasma folate. V108A and P160S variants reduce breast cancer risk. V108A and G245S varients are associated with prostate cancer risk. PMID: 23266799
  47. To conclude, GCPII haplotypes influenced susceptibility to stroke by influencing homocysteine levels. PMID: 23259322
  48. The survivin promoter exhibited a higher transcriptional activity than PSMA promoter and enhancer in prostate tumor cell lines. PMID: 22568207
  49. High expression of prostate-specific membrane antigen in the tumor-associated neo-vasculature is associated with worse prog-nosis in squamous cell carcinoma of the oral cavity. PMID: 22460809
  50. The PSM-E splice variant of PSMA suppression effect on cell proliferation is stronger compared to PSMA and the suppression effect on invasiveness is weaker than that of PSMA. PMID: 22322627

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Isoform PSMA']: Cytoplasm.
Protein Families
Peptidase M28 family, M28B subfamily
Tissue Specificity
Highly expressed in prostate epithelium. Detected in urinary bladder, kidney, testis, ovary, fallopian tube, breast, adrenal gland, liver, esophagus, stomach, small intestine, colon and brain (at protein level). Detected in the small intestine, brain, kid
Database Links

HGNC: 3788

OMIM: 600934

KEGG: hsa:2346

STRING: 9606.ENSP00000256999

UniGene: Hs.551896

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*