Recombinant human Peptidyl-prolyl cis-trans isomerase FKBP3

Code CSB-YP008699HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP008699HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP008699HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP008699HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
FKBP3
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
25 kDa FK506-binding protein; 25 kDa FKBP; FK506 binding protein 25 T cell; FK506 binding protein 25; T cell; 25-KD; FK506 binding protein 3 (25kD); FK506-binding protein 3; FKBP 25; FKBP 3; FKBP-25; FKBP-3; FKBP25; FKBP3; FKBP3_HUMAN; Immunophilin FKBP25; Peptidyl-prolyl cis-trans isomerase FKBP3; PPIase; PPIase FKBP3; Rapamycin binding protein; Rapamycin-selective 25 kDa immunophilin; Rotamase
Species
Homo sapiens (Human)
Expression Region
2-224aa
Target Protein Sequence
AAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Mol. Weight
41kD
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. PPIases accelerate the folding of proteins.
Gene References into Functions
  1. Taken together, these data clearly show that FKBP3/Sp1/HDAC2/p27 control cell proliferation during non-small cell lung cancer development. PMID: 28839465
  2. Data show that the N-terminus of FK506 binding protein-25 (FKBP25) is anchored to regions of dsRNA, whereas the FKBP domain is free to interact with neighboring proteins. PMID: 29036638
  3. Structural basis for nucleic acid recognition by FKBP25 has been uncovered. PMID: 26762975
  4. proteomics study indicates that the nuclear pool of the FKBP25 targets various nuclear proteins that are crucial for packaging of DNA, chromatin remodeling and pre-mRNA splicing PMID: 24998444
  5. FKBP25 is likely recruited to preribosomes to chaperone one of the protein components of the ribosome large subunit. PMID: 24840943
  6. structure of a unique N-terminal domain motif in the FKBP family, FKBP25(1-73), high-resolution structures show a new fold composed of five small helices where H3 and H4 are tilted in a novel arrangement; called Basic Tilted Helix Bundle (BTHB) domain. PMID: 24667607
  7. FKBP3, a novel regulator of the p53 pathway, induces the degradation of MDM2 and activation of p53. PMID: 19166840

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
FKBP-type PPIase family
Database Links

HGNC: 3719

OMIM: 186947

KEGG: hsa:2287

STRING: 9606.ENSP00000216330

UniGene: Hs.509226

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×