Recombinant human RING-box protein 2

Code CSB-BP019897HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP019897HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP019897HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
CKBBP 1; CKBBP1; CKII beta binding protein 1; CKII beta-binding protein 1; Rbx 2; Rbx2; RBX2_HUMAN; Regulator of cullins 2; RING box protein 2; RING finger protein 7; RING-box protein 2; RNF 7; RNF7; ROC 2; ROC2; SAG; Sensitive to apoptosis gene; Sensitive to apoptosis gene protein; Zinc RING finger protein SAG
Species
Homo sapiens (Human)
Expression Region
2-113aa
Target Protein Sequence
ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
Mol. Weight
39.9kD
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.
Gene References into Functions
  1. We demonstrated that RNF7 knockdown induced growth suppression of prostate cancer cells and inactivated ERK1/2 pathway, which suggested RNF7 might be a potential novel therapeutic target for CRPC. PMID: 28252001
  2. Results identified RNF7 to interact with CARMA2 regulating its NF-kappaB-activating capacity. Mechanistically, RNF7 influences CARMA2 signaling by regulating the ubiquitination state of MALT1 and the NF-kappaB-regulatory molecule NEMO. PMID: 29194363
  3. Sag is a Kras-cooperating oncogene that promotes lung tumorigenesis PMID: 24430184
  4. NEDD4-1 overexpression sensitizes cancer cells to etoposide-induced apoptosis by reducing SAG levels through targeted degradation. SAG is added to a growing list of NEDD4-1 substrates and mediates its biological function. PMID: 25216516
  5. RNF7 gene variant is associated with the risk of developing liver fibrosis and cirrhosis in an Eastern European population. PMID: 28338112
  6. MAF1, RNF7 and SETD3 are identified as PCNA-associated proteins in human cells and given this interaction with PCNA, Maf1, RNF7, and SetD3 are potentially involved in DNA replication, DNA repair, or associated processes. PMID: 26030842
  7. These findings indicate that Rbx1 and Rbx2 can both activate Cul5-Vif E3 ligase in vitro, but they may undergo a more delicate selection mechanism in vivo. PMID: 25912140
  8. Single nucleotide polymorphism rs16851720 was associated with liver fibrosis progression. PMID: 22841784
  9. Data suggest that the sensitive-to-apoptosis gene may be a candidate gene for good prognosis in rectal cancer, independent of therapeutic response of different individuals. PMID: 22171132
  10. SAG plays an important role in regulating ionizing radiation-induced apoptosis PMID: 20933570
  11. The findings showed that SAG E3 ubiquitin ligase plays an essential role in cancer cell proliferation and tumor growth PMID: 20103673
  12. SAG possesses a potent peroxidase property to decompose hydrogen peroxide in the presence of dithiothreitol PMID: 11999705
  13. results show that the Ring-H2 finger motif of CKBBP1 is necessary for efficient binding to CKIIbeta, as well as for optimal cell proliferation PMID: 12470599
  14. sensitive to apoptosis gene protein inhibits peroxynitrite-induced DNA damage. PMID: 12565832
  15. results indicate that protein kinase CKII may control IkappaBalpha and p27Kip1 degradation and thereby G1/S phase transition through the phosphorylation of threonine 10 within CKBBP1 protein PMID: 12748192
  16. These studies suggested that CK2 might regulate SAG-SCF E3 ligase activity through modulating SAG's stability, rather than its enzymatic activity directly. PMID: 16874460
  17. Endogenous levels of pro-caspase 3 were decreased by overexpression of SAG protein. PMID: 17217622
  18. Promotes hypoxia-inducible factor 1 alpha subunit (HIF-1 alpha) ubiquitination and degradation. PMID: 17828303
  19. Sensitive to apoptosis gene may play an important role in regulating the apoptosis induced by heat shock presumably through maintaining the cellular redox status. PMID: 18454945

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
RING-box family
Tissue Specificity
Expressed in heart, liver, skeletal muscle and pancreas. At very low levels expressed in brain, placenta and lung.
Database Links

HGNC: 10070

OMIM: 603863

KEGG: hsa:9616

STRING: 9606.ENSP00000273480

UniGene: Hs.134623

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1