Recombinant Rotavirus A Non-structural glycoprotein 4,partial

Code CSB-CF889507RFU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9PYC8
Relevance Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the rough endoplasmic reticulum during viral maturation Enterotoxin that causes a phospholipase C-dependent elevation of the intracellular calcium concentration in host intestinal mucosa cells. Increased concentration of intracellular calcium disrupts the cytoskeleton and the tight junctions, raising the paracellular permeability. Potentiates chloride ion secretion through a calcium ion-dependent signaling pathway, inducing age-dependent diarrhea. To perform this enterotoxigenic role in vivo, NSP4 is probably released from infected enterocytes in a soluble form capable of diffusing within the intestinal lumen and interacting with the plasma membrane receptors on neighboring epithelial cells. Possible receptors for NSP4 are alpha-1/beta-1 and alpha-2/beta-1 integrin heterodimers
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-CF889507RFU could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-CF889507RFU could indicate that this peptide derived from E.coli-expressed Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) glycoprotein 4.
Storage Buffer Tris-based buffer,50% glycerol
Species Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM
Research Area Others
Source in vitro E.coli expression system
Protein Names NCVP5 NS28
Expression Region 52-175aa
Tag Info N-terminal 6xHis-tagged and C-terminal Myc-tagged
Mol. Weight 21.7 kDa
Protein Description Cytoplasmic Domain
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the rough endoplasmic reticulum during viral maturation (By similarity).
Subcellular Location Non-structural glycoprotein 4: Host rough endoplasmic reticulum membrane, Single-pass type III membrane protein, Host membrane, host caveola, Single-pass type III membrane protein, Secreted
Protein Families Rotavirus NSP4 family

Related Products

Proteins

Proteins for Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)

Proteins for Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11]) (RV-A)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.