Recombinant Rotavirus A Non-structural glycoprotein 4,partial

Code CSB-EP889507RFU
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q9PYC8
Storage Buffer Tris-based buffer,50% glycerol
Species Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM
Research Area Others
Source E.coli
Protein Names Recommended name: Non-structural glycoprotein 4 Short name= NSP4 Alternative name(s): NCVP5 NS28
Expression Region 52-175aa
Tag Info N-terminal 6xHis-KSI-tagged
Mol. Weight 30.1 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the rough endoplasmic reticulum during viral maturation (By similarity).
Subcellular Location Non-structural glycoprotein 4: Host rough endoplasmic reticulum membrane, Single-pass type III membrane protein, Host membrane, host caveola, Single-pass type III membrane protein, Secreted
Protein Families Rotavirus NSP4 family

Related Products

Proteins

Proteins for Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11]) (RV-A)

Proteins for Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.