Recombinant Arabidopsis thaliana ABC transporter G family member 11 (ABCG11)

Code CSB-CF840432DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ABCG11
Uniprot No.
Alternative Names
ABCG11; COF1; DSO; PEL1; WBC11; At1g17840; F2H15.7; ABC transporter G family member 11; ABC transporter ABCG.11; AtABCG11; Protein CUTICULAR DEFECT AND ORGAN FUSION 1; Protein DESPERADO; Protein PERMEABLE LEAVES 1; White-brown complex homolog protein 11; AtWBC11
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-703
Target Protein Sequence
MEIEASRQQTTVPVSVGGGNFPVGGLSPLSEAIWREKAPTEFVGDVSARLTWQDLTVMVT MGDGETQNVLEGLTGYAEPGSLTALMGPSGSGKSTMLDALASRLAANAFLSGTVLLNGRK TKLSFGTAAYVTQDDNLIGTLTVRETIWYSARVRLPDKMLRSEKRALVERTIIEMGLQDC ADTVIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASAFFVTQTLRALSR DGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASDAYEFFAQAGFPCPALRNPSDH FLRCINSDFDKVRATLKGSMKLRFEASDDPLEKITTAEAIRLLVDYYHTSDYYYTAKAKV EEISQFKGTILDSGGSQASFLLQTYTLTKRSFINMSRDFGYYWLRLLIYILVTVCIGTIY LNVGTSYSAILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQRERLNGHYGVAAFVIAN TLSATPFLIMITFISGTICYFMVGLHPGFTHYLFFVLCLYASVTVVESLMMAIASIVPNF LMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQGQYQNDLRGLTFD SQGSAFKIPGEYVLENVFQIDLHRSKWINLSVILSMIIIYRIIFFIMIKTNEDVTPWVRG YIARRRMKQKNGTQNTTVAPDGLTQSPSLRNYIATRTDGARRW
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for the cuticle, root suberin and pollen coat development by controlling cutin and maybe wax transport to the extracellular matrix. Involved in developmental plasticity and stress responses. Together with ABCG9 and ABCG14, required for vascular development by regulating lipid/sterol homeostasis. May be a transporter of lignin precursors during tracheary element differentiation.
Gene References into Functions
  1. ABCG9, ABCG11 and ABCG14 are expressed in the vascular system. Mutations are responsible for defects in plant growth and affect vascular patterning. PMID: 24112720
  2. ABCG11 and ABCG12 form a heterodimer. ABCG11 trafficking to the plasma membrane is independent of ABCG12. PMID: 20870961
  3. The dso-4 phenotypes corresponded to the strong DSO/ABCG11 gene expression in the embryo epidermis as well as in the endosperm tissues of the developing seeds. Moreover, the DSO/ABCG11 protein displayed polar localization in the embryo protoderm. PMID: 20035035
  4. results show that WBC11 (At1g17840) functions in secretion of surface waxes, possibly by interacting with CER5; however, unlike ABCG12/CER5, ABCG11/WBC11 is important to the normal process of cutin formation PMID: 17727615
  5. findings show that DESPERADO (AtWBC11), encoding a plasma membrane-localized ATP-binding cassette transporter, is required for cutin transport to the extracellular matrix PMID: 17951461
  6. wax and cutin monomers were both reduced in the atwbc11 mutant. AtWBC11 was widely expressed in aerial organs. Interestingly, we found that the expression was light dependent, and the phytohormone ABA up-regulated AtWBC11 expression PMID: 17989085

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Tissue Specificity
Expressed in seedlings, roots, stems, leaves, flowers, and siliques, mostly in epidermis, trichomes, vasculatures and developing tissues. Follows an uniparental maternal expression in the seed, thus being the product of a maternally expressed imprinted ge
Database Links

KEGG: ath:AT1G17840

STRING: 3702.AT1G17840.1

UniGene: At.41813

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1