Recombinant Arabidopsis thaliana ABC transporter G family member 26(ABCG26)

Code CSB-CF885367DOA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names ABCG26
Uniprot No. Q9LK50
Alternative Names ABCG26; WBC27; At3g13220; MJG19.19; ABC transporter G family member 26; ABC transporter ABCG.26; AtABCG26; Putative white-brown complex homolog protein 27; AtWBC27
Species Arabidopsis thaliana (Mouse-ear cress)
Expression Region 1-685
Target Protein Sequence MEIRRSTEEVEENHVMQITGSNGIVHNMEFMPQAYLRNQYSSEIDIDEEFVSTYPLEDAP LPIFLKFEDVEYKVRNSHASSANLVKTMVSKVVTHTNPDPDGYKHILKGITGSTGPGEIL ALMGPSGSGKTTLLKIMGGRLTDNVKGKLTYNDIPYSPSVKRRIGFVTQDDVLLPQLTVE ETLAFAAFLRLPSSMSKEQKYAKIEMIIKELGLERCRRTRVGGGFVKGISGGERKRASIA YEILVDPSLLLLDEPTSGLDSTSATKLLHILQGVAKAGRTVITTIHQPSSRMFHMFDKLL LISEGHPAFYGKARESMEYFSSLRILPEIAMNPAEFLLDLATGQVSDISLPDELLAAKTA QPDSEEVLLKYLKQRYKTDLEPKEKEENHRNRKAPEHLQIAIQVKKDWTLSWWDQFLILS RRTFRERRRDYFDKLRLVQSLGVAVVLGLLWWKSKTDTEAHLRDQVGLMFYICIFWTSSS LFGAVYVFPFEKIYLVKERKAEMYRLSVYYVCSTLCDMVAHVLYPTFFMIIVYFMAEFNR NIPCFLFTVLTILLIAITSQGAGEFLGASVLSIKRAGMIASLVLMLFLLTGGYYVQHIPK FMQWLKYLSFMHYGFRLLLKVQYSADQLFECGSKGGCRTLQSSSSFDTINLNGGLQELWV LLAMAFGYRLCAYFCLRKKISICHL
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates the transport of sporopollenin precursors (e.g. polyketides) across the tapetum plasma membrane into the anther locule for polymerization on developing microspore walls, thus being required for male fertility and pollen exine formation and patterning prior to tapetum programmed cell death.
Gene References into Functions
  1. ABCG26-exported polyketides traffic from tapetal cells to form the sporopollenin backbone, in coordination with the trafficking of additional constituents, prior to tapetum programmed cell death. PMID: 25415974
  2. AtABCG26, which is required for pollen development in Arabidopsis. An AtABCG26 mutant developed very few pollen grains, resulting in a male-sterile phenotype. PMID: 21696844
  3. Arabidopsis thaliana ABCG26 plays a crucial role in the transfer of sporopollenin lipid precursors from tapetal cells to anther locules, facilitating exine formation on the pollen surface. PMID: 21223384
  4. results suggest that the ABC transporter, WBC27 (AT3G13220) plays important roles in the formation of arabidopsis exine, possibly by translocation of lipidic precursors of sporopollenin from tapetum to developing microspores PMID: 21205178
  5. ABCG26 is required for normal male fertility, exine formation, and pollen maturation. PMID: 20732973

Show More

Hide All

Subcellular Location Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Tissue Specificity Mostly expressed in flowers, especially in tapetum within anthers.
Database Links

KEGG: ath:AT3G13220

STRING: 3702.AT3G13220.1

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1