Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 2, chloroplastic (FTSH2)

Code CSB-CF528047DOA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
FTSH2
Uniprot No.
Alternative Names
FTSH2; VAR2; At2g30950; F7F1.16; ATP-dependent zinc metalloprotease FTSH 2, chloroplastic; AtFTSH2; Protein VARIEGATED 2
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
83-695
Target Protein Sequence
DEQGVSSSRMSYSRFLEYLDKDRVNKVDLYENGTIAIVEAVSPELGNRVERVRVQLPGLS QELLQKLRAKNIDFAAHNAQEDQGSVLFNLIGNLAFPALLIGGLFLLSRRSGGGMGGPGG PGNPLQFGQSKAKFQMEPNTGVTFDDVAGVDEAKQDFMEVVEFLKKPERFTAVGAKIPKG VLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCI VFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGVIVVAATNRADILDSAL LRPGRFDRQVSVDVPDVKGRTDILKVHAGNKKFDNDVSLEIIAMRTPGFSGADLANLLNE AAILAGRRARTSISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAVCGTLTPGH DAVQKVTLIPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEIIFGDSEVTTG AVGDLQQITGLARQMVTTFGMSDIGPWSLMDSSAQSDVIMRMMARNSMSEKLAEDIDSAV KKLSDSAYEIALSHIKNNREAMDKLVEVLLEKETIGGDEFRAILSEFTEIPPENRVPSST TTTPASAPTPAAV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Part of a complex that function as an ATP-dependent zinc metallopeptidase. Involved in the thylakoid formation and in the removal of damaged D1 in the photosystem II, preventing cell death under high-intensity light conditions, but not involved in thermotolerance.
Gene References into Functions
  1. the thylakoid membrane-bound FtsH5 and FtsH2 have dual functions in the maintenance of photosynthetic complexes. PMID: 27208291
  2. The initiation of (1)O2 signaling in grana margins depends on EX1 and the ATP-dependent zinc metalloprotease FtsH. As FtsH cleaves also the D1 protein during the disassembly of damaged PSII, EX1- and (1)O2-mediated signaling seems to be not only spatially but also functionally associated with the repair of PSII PMID: 27303039
  3. SVR10 and BPG2 are functionally related with VAR2, likely through their potential roles in regulating chloroplast protein homeostasis. PMID: 26435530
  4. A brief update of im and var2 and the functions of PTOX and AtFtsH2, is provided. PMID: 23703455
  5. The disruption of specific aspects of chloroplast translation, rather than a general impairment in chloroplast translation, suppress var2 variegation and the existence of complex genetic interactions in chloroplast development. PMID: 23721655
  6. These data demonstrate in vivo cooperative degradation of D1, in which Deg cleavage assists FtsH processive degradation under photoinhibitory conditions. PMID: 22698923
  7. To gain structural information of the possible complexes, the Arabidopsis FtsH2 (type B) and FtsH5 (type A) were modeled. PMID: 22558304
  8. Chloroplastic N-terminal methionine excision(cNME) acts upstream of the FtsH protease complex. Developmental defects and higher sensitivity to photoinhibition associated with the ftsh2 mutation were abolished when cNME was inhibited. PMID: 22010036
  9. In Arabidopsis thaliana, ATP-dependent chloroplast proteases belonging to FtsH family (especially FtsH2) are considered to be involved in aspects of chloroplast and whole plant maintenance under non-stressing as well as stressing conditions PMID: 21735825
  10. The Tat pathway integrates FtsH2 into thylakoids. PMID: 21214651
  11. Findings reinforce the strong genetic link between VAR2 and chloroplast translation, and point to a critical role of SVR3, and possibly some aspects of chloroplast translation, in the response of plants to chilling stress. PMID: 21187014
  12. The effect of FtsHs in D1 degradation was investigated in Arabidopsis (Arabidopsis thaliana) mutants lacking FtsH2 (yellow variegated2 [var2]) or FtsH5 (var1). PMID: 19767385
  13. Results showed that the conserved Gly-Ala-Asp motif plays an important role in FtsH activity and characterization of the var2 alleles could help to identify the physiologically important domain of FtsH. PMID: 15803409
  14. A model has been proposed to explain the mechanism of var2 variegation, which suggests that threshold levels of FtsH complexes are required for green sector formation. PMID: 16449381
  15. The white sectors in var2 are made by viable cells that have plastids arrested in thylakoid formation. PMID: 17449646
  16. These results indicate that photo-oxidative stress by excess light is involved in the regulation of respiratory gene expression and the modulation of respiratory properties, especially the AOX up-regulation. PMID: 18296449
  17. Data show that var2-mediated leaf variegation in Arabidopsis can be suppressed by mutations in SUPPRESSOR OF VARIEGATIONS. PMID: 18599582
  18. Chloroplast development promoted by the ectopic expression of GPA1 is dependent on FtsH2. PMID: 19228339

Show More

Hide All

Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein; Stromal side.
Protein Families
AAA ATPase family; Peptidase M41 family
Tissue Specificity
Expressed in cotyledons, cauline and rosette leaves, stems, sepals, flovers and siliques. Very low in roots.
Database Links

KEGG: ath:AT2G30950

STRING: 3702.AT2G30950.1

UniGene: At.22024

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X