Recombinant Arabidopsis thaliana Alternative oxidase 4, chloroplastic/chromoplastic (AOX4)

Code CSB-CF687974DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
AOX4
Uniprot No.
Alternative Names
AOX4; IM; PTOX; At4g22260; T10I14_90; Ubiquinol oxidase 4, chloroplastic/chromoplastic; Alternative oxidase 4; Plastid terminal oxidase; Protein IMMUTANS
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
57-351
Target Protein Sequence
ATILQDDEEKVVVEESFKAETSTGTEPLEEPNMSSSSTSAFETWIIKLEQGVNVFLTDSV IKILDTLYRDRTYARFFVLETIARVPYFAFMSVLHMYETFGWWRRADYLKVHFAESWNEM HHLLIMEELGGNSWWFDRFLAQHIATFYYFMTVFLYILSPRMAYHFSECVESHAYETYDK FLKASGEELKNMPAPDIAVKYYTGGDLYLFDEFQTSRTPNTRRPVIENLYDVFVNIRDDE AEHCKTMRACQTLGSLRSPHSILEDDDTEEESGCVVPEEAHCEGIVDCLKKSITS
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts early in chloroplast biogenesis as a component of a redox chain responsible for phytoene desaturation. Prevents the generation of toxic oxygen radicals and photooxidation of the nascent photosynthetic apparatus. Involved in the differentiation of multiple plastid types, including chloroplasts, amyloplasts, and etioplasts. Might participate in the chloroplast respiratory chain.
Gene References into Functions
  1. Data indicate that the protein level of plastid terminal oxidase (PTOX) was increased in the bacterial phytoene desaturase (CRTI)-expressing lines. PMID: 24378845
  2. the exon 8 domain of PTOX (IMMUTANS) is required for PTOX activity and stability in Arabidopsis PMID: 16249174
  3. IMMUTANS appears to be a versatile electron sink, especially early in chloroplast development, when its function is crucial for carotenoid biosynthesis, and in excess light, when it serves as a 'safety valve'. PMID: 16449381
  4. Neither functional analyses of the immutans (IM) knockout and overexpression lines nor meta-analyses of gene expression support the model that IM acts as a safety valve to regulate the redox state of the PQ pool during stress and acclimation PMID: 16891546
  5. Plants lacking IM have enhanced rates of carbon assimilation with corresponding increases in the activities of Rubisco and SPS, elevated starch and sucrose pool sizes, and an altered pattern of carbohydrate partitioning that favors sucrose over starch. PMID: 17342448
  6. Lack of colored carotenoids in the im white tissues elicits a differential response from a large number of genes involved in various cellular processes and stress responses. PMID: 19386811
  7. 14 conserved sites fall into three classes: Ala-139, Pro-142, Glu-171, Asn-174, Leu-179, Pro-216, Ala-230, Asp-287, and Arg-293 are dispensable for activity; Tyr-234 and Asp-295 are essential; and Leu-135, His-151, and Tyr-212 are important. PMID: 19542226
  8. In low light, thylakoids from PTOX overexpressed plants were protected against photoinhibition. PMID: 19740740

Show More

Hide All

Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein; Stromal side. Plastid, chromoplast membrane; Multi-pass membrane protein.
Protein Families
Alternative oxidase family
Tissue Specificity
Ubiquitous.
Database Links

KEGG: ath:AT4G22260

STRING: 3702.AT4G22260.1

UniGene: At.20480

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1