Recombinant Arabidopsis thaliana Aluminum-activated malate transporter 12 (ALMT12)

Code CSB-CF526193DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ALMT12
Uniprot No.
Alternative Names
ALMT12; QUAC1; At4g17970; T6K21.150; Aluminum-activated malate transporter 12; AtALMT12; Quick anion channel 1
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-560
Target Protein Sequence
MSNKVHVGSLEMEEGLSKTKWMVLEPSEKIKKIPKRLWNVGKEDPRRVIHALKVGLSLTL VSLLYLMEPLFKGIGSNAIWAVMTVVVVLEFSAGATLCKGLNRGLGTLIAGSLAFFIEFV ANDSGKVLRAIFIGTAVFIIGAAATYIRFIPYIKKNYDYGVVIFLLTFNLITVSSYRVDS VINIAHDRFYTIAVGCGICLFMSLLVFPIWSGEDLHKTTVGKLQGLSRSIEACVDEYFEE KEKEKTDSKDRIYEGYQAVLDSKSTDETLALYANWEPRHTLRCHRFPCQQYVKVGAVLRQ FGYTVVALHGCLQTEIQTPRSVRALFKDPCVRLAGEVCKALTELADSISNHRHCSPEILS DHLHVALQDLNSAIKSQPKLFLGSNLHRHNNKHQNGSISNNKHHQRNSSNSGKDLNGDVS LQNTETGTRKITETGSRQGQNGAVSLSSFRTDTSALMEYRRSFKNSNSEMSAAGERRMLR PQLSKIAVMTSLEFSEALPFAAFASLLVEMVARLDNVIEEVEELGRIASFKEYDNKRDQT ADDVRCENPANVTISVGAAE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Malate-sensitive anion transporter permeable to chloride, nitrate, sulfate and malate. Involved in dark-, CO(2)-, abscisic acid- and water-deficient-induced stomatal closure. Belongs to the R-type anion channels.
Gene References into Functions
  1. ALMT12 role in drought induced stomatal closure PMID: 28446637
  2. QUAC1, an R-type anion channel responsible for the release of malate from guard cells, is essential for efficient stomatal closure and plays a role in mesophyll conductance. PMID: 26542441
  3. In the presence of abscissic acid, OST1 is able to phosphorylate/activate the plant anion channels QUAC1 and SLAC1, leading to stomatal closure.[QUAC1] PMID: 23452338
  4. The cytosolic C-terminus is involved in the voltage-dependent gating mechanism of QUAC1. PMID: 23314055
  5. Activity of heterologously expressed AtALMT12 depends on extracellular malate. Thereby this key metabolite and osmolite of guard cells shifts the threshold for voltage activation of AtALMT12 towards more hyperpolarized potentials. PMID: 20626656
  6. AtALMT12 is a novel class of anion transporter involved in stomatal closure. PMID: 20154005

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=PubMed:20626656 indicates also a not confirmed endomembrane localization.
Protein Families
Aromatic acid exporter (TC 2.A.85) family
Tissue Specificity
Expressed in roots, stems, leaves, flowers and pollen. Mainly detected in the roots vascular stele and in the leaves guard cells.
Database Links

KEGG: ath:AT4G17970

STRING: 3702.AT4G17970.1

UniGene: At.2053

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×