Recombinant Arabidopsis thaliana Aluminum-activated malate transporter 1 (ALMT1)

Code CSB-CF865904DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ALMT1
Uniprot No.
Alternative Names
ALMT1; At1g08430; T27G7.11; Aluminum-activated malate transporter 1; AtALMT1
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-493
Target Protein Sequence
MEKVREIVREGIRVGNEDPRRIIHAFKVGLALVLVSSFYYYQPFGPFTDYFGINAMWAVM TVVVVFEFSVGATLGKGLNRGVATLVAGGLGIGAHQLARLSGATVEPILLVMLVFVQAAL STFVRFFPWVKTKFDYGILIFILTFALISLSGFRDEEIMDLAESRLSTVVIGGVSCILIS IFVCPVWAGQDLHSLLASNFDTLSHFLQDFGDEYFEAREKGDYKVVEKRKKNLERYKSVL DSKSDEEALANYAEWEPPHGQFRFRHPWKQYVAVGALLRQCAYRIDALNSYINSDFQIPV DIKKKLETPLRRMSSESGNSMKEMSISLKQMIKSSSSDIHVSNSQAACKSLSTLLKSGIL NDVEPLQMISLMTTVSMLIDIVNLTEKISESVHELASAARFKNKMRPTVLYEKSDSGSIG RAMPIDSHEDHHVVTVLHDVDNDRSNNVDDSRGGSSQDSCHHVAIKIVDDNSNHEKHEDG EIHVHTLSNGHLQ
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Malate transporter critical for aluminum tolerance. The STOP1 transcription factor is required for ALMT1 expression.
Gene References into Functions
  1. Results indicate STOP1 and ALMT1 as a signalling pathway of low phosphate (Pi) availability and exuded malate as an unexpected apoplastic inhibitor of root cell wall expansion. PMID: 28504266
  2. CALMODULIN-BINDING TRANSCRIPTION ACTIVATOR2 to be an activator of AtALMT1 expression. PMID: 25627216
  3. The exudation of malic acid from roots in response to Ni treatment in either susceptible or tolerant plant species was found to be partially dependent on AtALMT1 expression. PMID: 22411507
  4. Expression of AtALMT1(P)::AtMATE not only significantly increased Al resistance of the transgenic plants, but also enhanced carbon-use efficiency for Al resistance. PMID: 22413742
  5. overexpression of AtALMT1 can be used as an approach to enhance a plant's ability to release malate into the rhizosphere. PMID: 23857348
  6. WRKY46 functions in Al sensitivity through regulating the expression of ALMT1. WRKY46 represses ALMT1 expression and malate secretion. PMID: 24118304
  7. the complex regulation of AtALMT1 expression in response to phytohormones shows the change in AtALMT1 expression during the adaptation to abiotic and biotic stresses PMID: 23624855
  8. AtALMT1 is an essential factor for Aluminum tolerance in Arabidopsis but does not represent the major aluminum tolerance QTL also found on chromosome 1 [AtALMT1] PMID: 16740662
  9. This study characterized AtALMT1, an Arabidopsis aluminum-activated malate transporter, to clarify its specific role in malate release and aluminum stress responses. PMID: 17885092
  10. AtALMT1 functions independently from AtMATE to confer aluminum tolerance. PMID: 18826429

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Aromatic acid exporter (TC 2.A.85) family
Tissue Specificity
Expressed in roots, but not in shoots. Detected in the root apex in absence of aluminum stress and in root apices, the stele and endodermis of the elongating zone of primary and lateral roots after aluminum stress. Not expressed in cortical and epidermal
Database Links

KEGG: ath:AT1G08430

STRING: 3702.AT1G08430.1

UniGene: At.42261

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1