Recombinant Arabidopsis thaliana Bax inhibitor 1 (BI-1)

Code CSB-CF873243DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
BI-1
Uniprot No.
Alternative Names
BI-1; At5g47120; K14A3.7; Bax inhibitor 1; AtBI-1; BI-1
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-247
Target Protein Sequence
MDAFSSFFDSQPGSRSWSYDSLKNFRQISPAVQNHLKRVYLTLCCALVASAFGAYLHVLW NIGGILTTIGCIGTMIWLLSCPPYEHQKRLSLLFVSAVLEGASVGPLIKVAIDVDPSILI TAFVGTAIAFVCFSAAAMLARRREYLYLGGLLSSGLSMLMWLQFASSIFGGSASIFKFEL YFGLLIFVGYMVVDTQEIIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADKEE KKKKRRN
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Suppressor of apoptosis. Modulator of endoplasmic reticulum stress-mediated programmed cell death. Involved in methyl jasmonate-induced leaf senescence through regulating cytoplasmic calcium level.
Gene References into Functions
  1. BI-1 affects cell death-associated components localized in sphingolipid-enriched microdomains of the plasma membrane. PMID: 26297139
  2. AtBI-1 contributes to synthesis of sphingolipids during cold stress by interacting with AtSLD1, AtFAH1, AtSBH2 and AtADS2. PMID: 24687220
  3. Arabidopsis thaliana BI-1-interacting proteins were identified. PMID: 23782494
  4. Overexpression of AtBI-1 increases the amount of 2-hydroxy fatty acids. PMID: 19054355
  5. BAX INHIBITOR 1 is an attenuator for cell death progression triggered by both biotic and abiotic types of cell death signals in Arabidopsis. PMID: 16507080
  6. The expression of AtBI-1, which suppresses Bax-induced cell death, in the tapetum at the tetrad stage inhibits tapetum degeneration and subsequently results in pollen abortion, while activation of AtBI-1 at the later stage does not. PMID: 16565524
  7. A study evaluating the effect of AtBI-1 on calcium homeostasis is reported. PMID: 17142482
  8. BI-1 requires normal electron transport activity to suppress cell death in yeast PMID: 17825821
  9. Results indicate that the loss of calmodulin binding reduces the cell death suppressor activity of Bax inhibitor-1 in planta. PMID: 19674971

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
BI1 family
Tissue Specificity
Expressed in root tips, root vasculature, flower tissues, including stamens and sepals, and in the base of siliques. Not detected in mature leaves.
Database Links

KEGG: ath:AT5G47120

STRING: 3702.AT5G47120.1

UniGene: At.24669

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×