Recombinant Arabidopsis thaliana Calcium-activated outward-rectifying potassium channel 1 (KCO1)

Code CSB-CF814494DOA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
TPK1
Uniprot No.
Alternative Names
TPK1; KCO1; At5g55630; MDF20.7; Two-pore potassium channel 1; AtTPK1; Calcium-activated outward-rectifying potassium channel 1; AtKCO1
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-363
Target Protein Sequence
MSSDAARTPLLPTEKIDTMAQDFNLNSRTSSSRKRRLRRSRSAPRGDCMYNDDVKIDEPP PHPSKIPMFSDLNPNLRRVIMFLALYLTIGTLCFYLVRDQISGHKTSGVVDALYFCIVTM TTVGYGDLVPNSSASRLLACAFVFSGMVLVGHLLSRAADYLVEKQEALLVRAFHLRQSFG PTDILKELHTNKLRYKCYATCLVLVVLFIVGTIFLVMVEKMPVISAFYCVCSTVTTLGYG DKSFNSEAGRLFAVFWILTSSICLAQFFLYVAELNTENKQRALVKWVLTRRITNNDLEAA DLDEDGVVGAAEFIVYKLKEMGKIDEKDISGIMDEFEQLDYDESGTLTTSDIVLAQTTSQ IQR
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Voltage-independent, large conductance and potassium-selective tonoplast ion channel. Regulated by cytoplasmic calcium and pH. Does not mediate slow-vacuolar (SV) ionic currents, but essential to establish VK currents. Has some permeability for Rb(+) and NH(4)(+), but none for Na(+), Cs(+) or Li(+). Involved in intracellular K(+) redistribution and/or K(+) retranslocation between different tissues.
Gene References into Functions
  1. ATKCO1 can form functional potassium transport systems in E. coli PMID: 23656881
  2. TPK1 must assemble correctly to pass endoplasmic reticulum quality control. PMID: 21697507
  3. data clearly demonstrate that TPK1 (KCO1) is a voltage-independent, Ca(2+)-activated, K(+)-selective ion channel in the vacuolar membrane that does not mediate SV-type ionic currents [TPK1] PMID: 16113216
  4. The two-pore channel TPK1 gene encodes the vacuolar K+ conductance and plays a role in K+ homeostasis. PMID: 17563365
  5. findings show that AtTPK1 (KCO1), interacts with 14-3-3 proteins (general regulating factors, GRFs; TPK1 seems to provide for a Ca(2+)- and 14-3-3-sensitive mechanism capable of controlling cytoplasmic potassium homeostasis in plants PMID: 17764516

Show More

Hide All

Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.
Protein Families
Two pore domain potassium channel (TC 1.A.1.7) family
Tissue Specificity
Detected in mesophyll cells, guard cells and vascular tissues of the leaves. Expressed in the hilum, where the funiculus is attached during fruit maturation and in the embryo. Also expressed at a lower level in seedlings, root tips and elongation zones, a
Database Links

KEGG: ath:AT5G55630

STRING: 3702.AT5G55630.1

UniGene: At.20254

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X