Recombinant Arabidopsis thaliana Cyclic nucleotide-gated ion channel 2 (CNGC2)

Code CSB-CF527733DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CNGC2
Uniprot No.
Alternative Names
CNGC2; DND1; At5g15410; T20K14_20; Cyclic nucleotide-gated ion channel 2; AtCNGC2; Cyclic nucleotide- and calmodulin-regulated ion channel 2; Protein DEFENSE NO DEATH 1
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-726
Target Protein Sequence
MPSHPNFIFRWIGLFSDKFRRQTTGIDENSNLQINGGDSSSSGSDETPVLSSVECYACTQ VGVPAFHSTSCDQAHAPEWRASAGSSLVPIQEGSVPNPARTRFRRLKGPFGEVLDPRSKR VQRWNRALLLARGMALAVDPLFFYALSIGRTTGPACLYMDGAFAAVVTVLRTCLDAVHLW HVWLQFRLAYVSRESLVVGCGKLVWDPRAIASHYARSLTGFWFDVIVILPVPQAVFWLVV PKLIREEKVKLIMTILLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTIWWGFALNLIAY FIASHVAGGCWYVLAIQRVASCIRQQCMRTGNCNLSLACKEEVCYQFVSPTSTVGYPCLS GNLTSVVNKPMCLDSNGPFRYGIYRWALPVISSNSLAVKILYPIFWGLMTLSTFANDLEP TSNWLEVIFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRDMEWWMKRRQLPS RLRQRVRRFERQRWNALGGEDELELIHDLPPGLRRDIKRYLCFDLINKVPLFRGMDDLIL DNICDRAKPRVFSKDEKIIREGDPVQRMIFIMRGRVKRIQSLSKGVLATSTLEPGGYLGD ELLSWCLRRPFLDRLPPSSATFVCLENIEAFSLGSEDLRYITDHFRYKFANERLKRTARY YSSNWRTWAAVNIQMAWRRRRKRTRGENIGGSMSPVSENSIEGNSERRLLQYAAMFMSIR PHDHLE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as cyclic nucleotide-gated ion channel. Permeable to potassium and calcium in a cyclic nucleotide-dependent fashion (cAMP or cGMP). Could also transport lithium, cesium and rubium and displays a strong selectivity against sodium. Seems to directly participate in pathogen-induced calcium influx. May function in homeostasis, re-establishing ionic balance after defense action and/or other stimuli. Could mediate the initiation of the developmentally regulated cell death programs.
Gene References into Functions
  1. These results suggest that the stage-dependent differences in heat stress response of Arabidopsis regulated by CNGC2 might rely on regulatory mechanisms of APX1-and MBF1c-dependent pathways and H2O2 homeostasis. PMID: 29275210
  2. CNGC2 is the key factor mediating Ca2+ influx into the leaf cells. PMID: 27999084
  3. results indicate that S gene function of DND1 is conserved in tomato and potato. We discuss the possibilities of using RNAi silencing or loss-of-function mutations of DND1 orthologs, as well as additional S gene orthologs from Arabidopsis, to breed for resistance to pathogens in crop plants. PMID: 26577903
  4. Arabidopsis thaliana cyclic nucleotide-gated channel 2 (AtCNGC2) is involved in jasmonic acid (JA)-induced apoplastic Ca(2+) influx in Arabidopsis epidermal cells. PMID: 26608645
  5. This indicates that AtCNGC2 and AtCNGC4 have a unique role controlling flowering timing and this function is independent from its role in pathogen defense. PMID: 25719935
  6. AtCNGC2 and AtCNGC4 are likely part of the same channel complex. PMID: 24027242
  7. Disruption of Arabidopsis CNGC2 impairs plant growth and heat sensing. PMID: 22904147
  8. Study expand the discussion of CNGC2 mediated Ca(2+) uptake and other related signaling components involved in the plant senescence signaling cascade. PMID: 21358265
  9. in a signaling cascade, the cGMP-activated channel CNGC2 is involved in AtPep- and PepR1-dependent inward Ca2+ conductance and resulting cytosolic Ca2+ elevation PMID: 21088220
  10. The CNGC2 loss-of-function mutant displays early senescence phenotypes and has a lower endogenous NO level in leaves compared to the wild-type . PMID: 20699402
  11. Arabidopsis thaliana CYCLIC NUCLEOTIDE GATED CHANNEL2 (CNGC2/DND1) conducts Ca(2+) into cells and provide a model linking this Ca(2+) current to downstream nitric oxide production. PMID: 17384171
  12. Transcriptional responses to growth in high environmental calcium concentrations were characterized and compared between wild-type and mutant Arabidopsis plants containing a knockout mutation in the gene encoding a cyclic nucleotide-gated channel (CNGC2). PMID: 18307990
  13. The findings indicate that the broad-spectrum resistance of dnd1 mutants occurs due to activation or sensitization of multiple defense pathways, yet none of the investigated pathways are required for the reduced-HR phenotype. PMID: 18785824
  14. sporophytic, but not gametophytic, defects are the main cause of the observed reduction in seed yield in cngc2 plants, and suggest that correct cyclic nucleotide and calcium signaling are important for cell elongation and pollen tube guidance. PMID: 19368669

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family
Tissue Specificity
Expressed in the whole plant but only weakly in roots. Strongly expressed in the expanded cotyledons of 14-day-old seedlings and detected later in leaves after the transition to flowering. Also detected in flowers during organ senescence and in the dehisc
Database Links

KEGG: ath:AT5G15410

STRING: 3702.AT5G15410.1

UniGene: At.20813

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×