Recombinant Arabidopsis thaliana Ethylene receptor 1 (ETR1)

Code CSB-CF344583DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ETR1
Uniprot No.
Alternative Names
ETR1; At1g66340; T27F4.9; Ethylene receptor 1; AtETR1; Protein ETHYLENE RESPONSE 1; Protein ETR1
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-738
Target Protein Sequence
MEVCNCIEPQWPADELLMKYQYISDFFIAIAYFSIPLELIYFVKKSAVFPYRWVLVQFGA FIVLCGATHLINLWTFTTHSRTVALVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTREL FLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECA LWMPTRTGLELQLSYTLRHQHPVEYTVPIQLPVINQVFGTSRAVKISPNSPVARLRPVSG KYMLGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVA DQVAVALSHAAILEESMRARDLLMEQNVALDLARREAETAIRARNDFLAVMNHEMRTPMH AIIALSSLLQETELTPEQRLMVETILKSSNLLATLMNDVLDLSRLEDGSLQLELGTFNLH TLFREVLNLIKPIAVVKKLPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSI SVTALVTKSDTRAADFFVVPTGSHFYLRVKVKDSGAGINPQDIPKIFTKFAQTQSLATRS SGGSGLGLAISKRFVNLMEGNIWIESDGLGKGCTAIFDVKLGISERSNESKQSGIPKVPA IPRHSNFTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKVVFMDV CMPGVENYQIALRIHEKFTKQRHQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDN IRDVLSDLLEPRVLYEGM
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ethylene receptor related to bacterial two-component regulators. Acts as a redundant negative regulator of ethylene signaling. In the presence of ethylene, the auto-kinase activity of ETR1 is inhibited and the non-phosphorylated kinase domain binds tightly to the corresponding domain of EIN2.
Gene References into Functions
  1. ETR1-receiver domain already exists as an active formation and executes its function through binding with the downstream factors without phosphorylation. PMID: 27486797
  2. The ETR1 receiver domain has multiple functions where different surfaces are involved in the control of different traits. PMID: 26160962
  3. Data show that the cytosolic domain of ETR1 plays a key role, interacting with all other receptors and several participants of the ethylene signaling pathway. PMID: 25451923
  4. Data show that Bacillus sp B55, which associated with Nicotiana attenuata roots, promotes growth of wild-type and, particularly, ethylene (ET)-insensitive (35)S-ethylene response1 (etr1) plants expressing the mutant Arabidopsis thaliana receptor ETR1-1. PMID: 23903320
  5. Histidine kinase activity of ETR1 is not required for but plays a modulating role in the regulation of ethylene responses. PMID: 22467798
  6. Transgenic and genetic analyses revealed that this organelle abnormality was not linked to etr1-1 or ethylene signaling, but linked to a second mutation in ARC3, which was further verified by genetic complementation analysis. PMID: 22228186
  7. A mutation in the kinase domain of ETR1 that prevents auto-phosphorylation (H353A), increases the affinity of the receptors for EIN2. PMID: 20591837
  8. Impaired perception of ethylene via ETR1 results in increased disease resistance to Verticillium dahliae. PMID: 20447269
  9. Induction of etr1-1 expression repressed the epinastic response to ethylene as well as delayed fruit ripening. Restoration of ethylene sensitivity was achieved following the cessation of the induction PMID: 20181754
  10. Inhibition of autophosphorylation in ETR1 by cyanide in Arabidopsis thaliana can be controlled by etehylene or ethylene agonists. PMID: 19825547
  11. histidine kinase activity is not necessary for ethylene receptor function in plants and its signal transduction does not occur through a phosphorelay mechanism PMID: 15358768
  12. The His kinase domain in the C-terminal region of Arabidopsis ETR1 plays a role in the repression of ethylene responses. PMID: 15466228
  13. Five receptor isoforms from Arabidopsis thaliana confirmed that all members of the family are capable of high-affinity ethylene-binding activity. PMID: 15703053
  14. Data demonstrate an unexpected role for ETR1, that of mediating stomatal closure in response to H2O2. PMID: 15761208
  15. These findings demonstrate that RTE1 is a negative regulator of ethylene signaling and suggest that RTE1 plays an important role in ETR1 function. PMID: 16682642
  16. Possible roles of subfamily I receptors and disulfide linkages in ETR1 receptor signal output mediated through the N terminus are discussed. PMID: 16891553
  17. The ETR1 receptor is required for ethylene-stimulated nutations. PMID: 17071649
  18. These findings yield insight into the structure and function of the ethylene binding domain (EBD) and suggest a conserved role of the EBD as a negative regulator of the signal transmitter domain. PMID: 17189345
  19. The role of the histidine kinase activity of ETR1 in A. thaliana growth and development is reported. PMID: 17284582
  20. ETR1 is positively regulated by RTE1 via the ethylene-binding domain, independently from RAN1 activity. PMID: 18643990

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Ethylene receptor family
Tissue Specificity
Leaves, roots, stems, seedlings, flowers, anthers, carpels and ovules.
Database Links

KEGG: ath:AT1G66340

STRING: 3702.AT1G66340.1

UniGene: At.43238

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1