Recombinant Arabidopsis thaliana Fatty acid amide hydrolase (FAAH)

Code CSB-CF007938DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
FAAH
Uniprot No.
Alternative Names
FAAH; At5g64440; T12B11.3; Fatty acid amide hydrolase; AtFAAH; N-acylethanolamine amidohydrolase
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-607
Target Protein Sequence
MGKYQVMKRASEVDLSTVKYKAETMKAPHLTGLSFKLFVNLLEAPLIGSLIVDYLKKDNG MTKIFRNTVIPEEPMFRPEFPSQEPEHDVVIVGEDESPIDRLETALKCLPQYDPSRSLHA DPVSSFRYWKIRDYAYAYRSKLTTPLQVAKRIISIIEEFGYDKPPTPFLIRFDANEVIKQ AEASTRRFEQGNPISVLDGIFVTIKDDIDCLPHPTNGGTTWLHEDRSVEKDSAVVSKLRS CGAILLGKANMHELGMGTTGNNSNYGTTRNPHDPKRYTGGSSSGSAAIVAAGLCSAALGT DGGGSVRIPSALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFLVYAAILGS SSADRYNLKPSPPCFPKLLSHNGSNAIGSLRLGKYTKWFNDVSSSDISDKCEDILKLLSN NHGCKVVEIVVPELEEMRAAHVISIGSPTLSSLTPYCEAGKNSKLSYDTRTSFAIFRSFS ASDYIAAQCLRRRLMEYHLNIFKDVDVIVTPTTGMTAPVIPPDALKNGETNIQVTTDLMR FVLAANLLGFPAISVPVGYDKEGLPIGLQIMGRPWAEATVLGLAAAVEELAPVTKKPAIF YDILNTN
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the hydrolysis of bioactive endogenous fatty acid amides to their corresponding acids. The hydrolysis of endogenous amidated lipids terminates their participation as lipid mediators in various signaling systems (Probable). Converts a wide range of N-acylethanolamines (NAEs) to their corresponding free fatty acids and ethanolamine. Can use oleamide as substrate, but not indole-3-acetamide, 1-naphtalene-acetamide, nicotinic acid amide or L-asparagine. Can use 2-arachidonylglycerol as substrate. Participates in the regulation of plant growth. Hydrolyzes N-dodecanoylethanolamine, which is has a growth inhibitory effect on seedling growth. Involved in plant defense signaling. Involved in abscisic acid (ABA) signaling through mechanisms that are independent of the catalytic activity. Involved in the regulation of flowering time. Catalyzes the hydrolysis of N-acyl L-homoserine lactones (AHLs), which are a class of signaling molecules produced by bacteria for quorum sensing. Accumulation of L-homoserine appears to encourage plant growth at low concentrations by stimulating transpiration, but higher concentrations inhibit growth by stimulating ethylene production.
Gene References into Functions
  1. our study demonstrates the feasibility of using an unbiased chemical genetic approach to identify new pharmacological tools for manipulating FAAH- and NAE-mediated physiological processes in plants. PMID: 28112243
  2. AtFAAH is one, but not the only, modulator of endogenous N-Acylethanolamines (NAE) levels in plants, and that NAE depletion likely participates in the regulation of plant growth [fatty acid amide hydrolase] [AtFAAH] PMID: 16880402
  3. Overexpression of AtFAAH inhibits innate immunity against Pseudomonas syringae in Arabidopsis, and plants had lower amounts of jasmonic acid, abscisic acid, and salicylic acid. PMID: 18643971
  4. AtFAAH influences plant growth and interacts with ABA signaling and plant defense through distinctly different mechanisms PMID: 19801664
Subcellular Location
Endoplasmic reticulum membrane. Cell membrane.
Protein Families
Amidase family
Tissue Specificity
Expressed in roots, leaves and flowers. Expressed in seedlings, flowers, roots, siliques, seeds and leaves.
Database Links

KEGG: ath:AT5G64440

STRING: 3702.AT5G64440.1

UniGene: At.19619

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×