Recombinant Arabidopsis thaliana G-protein coupled receptor 1(GCR1)

Code CSB-CF009728DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O04714
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MSAVLTAGGGLTAGDRSIITAINTGASSLSFVGSAFIVLCYCLFKELRKFSFKLVFYLAL SDMLCSFFLIVGDPSKGFICYAQGYTTHFFCVASFLWTTTIAFTLHRTVVKHKTDVEDLE AMFHLYVWGTSLVVTVIRSFGNNHSHLGPWCWTQTGLKGKAVHFLTFYAPLWGAILYNGF TYFQVIRMLRNARRMAVGMSDRVDQFDNRAELKVLNRWGYYPLILIGSWAFGTINRIHDF IEPGHKIFWLSVLDVGTAALMGLFNSIAYGFNSSVRRAIHERLELFLPERLYRWLPSNFR PKNHLILHQQQQQRSEMVSLKTEDQQ
Source in vitro E.coli expression system
Gene Names GCR1
Protein Names Recommended name: G-protein coupled receptor 1
Expression Region 1-326
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Together with GPA1, may regulate the cell cycle via a signaling cascade that uses phosphatidylinositol-specific phospholipase C (PI-PLC) as an effector and inositol 1,4,5-trisphosphate(IP(3)) as a second messenger. Acts as a negative regulator of GPA1-mediated abscisic acid (ABA) responses in guard cells, and together with GPA1 and GB1 during seed germination and early seedling development. Promotes PI-PLC activity and IP(3) accumulation. Involved in the blue light (BL) signaling. Together with GPA1 and ADT3, required for BL-mediated synthesis of phenylpyruvate and subsequently of phenylalanine (Phe), in etiolated seedlings. Probably involved in cytokinin signal transduction. Plays a positive role in gibberellin- (GA) and brassinosteroid- (BR) regulated seed germination, probably independently of a heterotrimeric G-protein. Mediates seed dormancy abolition, and promotes seed germination and flowering.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Tissue Specificity Mostly present in the meristematic regions. Expressed at low levels in seedlings, vascular tissues of cotyledons, hypocotyl, and roots, stems, leaves, flowering buds and siliques. In dark-grown seedlings, localized in the cotyledons and the hook.
Database Links

KEGG: ath:AT1G48270

STRING: 3702.AT1G48270.1

UniGene: At.21469

Related Products

GCR1 Antibodies

GCR1 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

GCR1 Proteins

GCR1 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.