Recombinant Arabidopsis thaliana Mitochondrial carnitine/acylcarnitine carrier-like protein(BOU)

Code CSB-CF856673DOA
Size Pls inquire other sizes
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names BOU
Uniprot No. Q93XM7
Alternative Names BOU; At5g46800; MZA15.23; Mitochondrial carnitine/acylcarnitine carrier-like protein; Carnitine/acylcarnitine translocase-like protein; CAC-like protein; Protein A BOUT DE SOUFFLE
Species Arabidopsis thaliana (Mouse-ear cress)
Expression Region 1-300
Target Protein Sequence MADAWKDLASGTVGGAAQLVVGHPFDTIKVKLQSQPTPAPGQLPRYTGAIDAVKQTVASE GTKGLYKGMGAPLATVAAFNAVLFTVRGQMEGLLRSEAGVPLTISQQFVAGAGAGFAVSF LACPTELIKCRLQAQGALAGASTTSSVVAAVKYGGPMDVARHVLRSEGGARGLFKGLFPT FAREVPGNATMFAAYEAFKRFLAGGSDTSSLGQGSLIMAGGVAGASFWGIVYPTDVVKSV LQVDDYKNPRYTGSMDAFRKILKSEGVKGLYKGFGPAMARSVPANAACFLAYEMTRSSLG
Protein Length full length protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Involved in photorespiratory metabolism. Acts probably as a carrier for a glycine decarboxylase (GDC) cofactor or, alternatively, may act as a mitochondrial glycine shuttle. Involved in the transition from the embryonic stage to the juvenile autotrophic stage.
Gene References into Functions
  1. The BOU transporter protein is essential for the function of the photorespiratory metabolism. PMID: 23181524
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity High expression in cotyledons, leaves, flowers and developing siliques. Lower expression in roots and maturing siliques. Not detected in meristematic tissues.
Database Links

KEGG: ath:AT5G46800

STRING: 3702.AT5G46800.1

UniGene: At.23694

Most popular with customers

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1