Product Details

Target Names

FAD2

Uniprot No.

Alternative Names

FAD2; At3g12120; T21B14.6; T21B14_107; T23B7.6; Delta(12-fatty-acid desaturase; Fatty acid desaturase 2; Omega-6 fatty acid desaturase, endoplasmic reticulum

Species

Arabidopsis thaliana (Mouse-ear cress)

Expression Region

1-383

Target Protein Sequence

MGAGGRMPVPTSSKKSETDTTKRVPCEKPPFSVGDLKKAIPPHCFKRSIPRSFSYLISDI IIASCFYYVATNYFSLLPQPLSYLAWPLYWACQGCVLTGIWVIAHECGHHAFSDYQWLDD TVGLIFHSFLLVPYFSWKYSHRRHHSNTGSLERDEVFVPKQKSAIKWYGKYLNNPLGRIM MLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIYLSDAGILAVCFGLY RYAAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPSLPHYDSSEWDWLRGALATVDRD YGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQFDGTPWYVAMYREAK ECIYVEPDREGDKKGVYWYNNKL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

ER (microsomal) omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 18:3 fatty acids, important constituents of plant membranes. Delta(12)-desaturase with regioselectivity determined by the double bond (delta(9) position) and carboxyl group of the substrate. Can use both 16:1 and 18:1 fatty acids as substrates. It is thought to use cytochrome b5 as an electron donor and to act on fatty acids esterified to phosphatidylcholine (PC) and, possibly, other phospholipids. Very low constitutive hydroxylation activity. Required for desaturation of fatty acids present in extraplastidial membranes, including mitochondria. Required for salt tolerance during seed germination and early seedling growth.

Gene References into Functions

Data suggest that omega-6 desaturation is largely controlled by cis-acting sequence variants in the fatty acid desaturase 2 (FAD2) 5' untranslated region intron that determine the expression level of the gene. PMID: 28108698
FAD2 and FATB may have influenced the adaptive evolution of seed oil composition to optimize seed oil melting point relative to germination temperatures PMID: 26865732
Results suggest that FAD2 mediated high-level vacuolar and plasma membrane fatty acid desaturation is essential for the proper function of membrane attached Na+/H+ exchangers. PMID: 22279586

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein.

Protein Families

Fatty acid desaturase type 1 family

Tissue Specificity

Expressed in shoots and roots. Expressed in leaves, stems, flowers and siliques.

Database Links

KEGG: ath:AT3G12120

STRING: 3702.AT3G12120.1

UniGene: At.23898

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-CF342791DOA
MSDS	MSDS Datasheet
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Arabidopsis thaliana Delta(12)-fatty-acid desaturase (FAD2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage