Recombinant Arabidopsis thaliana Phosphate transporter PHO1(PHO1)

Code CSB-CF844594DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8S403
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MVKFSKELEAQLIPEWKEAFVNYCLLKKQIKKIKTSRKPKPASHYPIGHHSDFGRSLFDP VRKLARTFSDKLFSNSEKPEILQVRRRRGSSETGDDVDEIYQTELVQLFSEEDEVKVFFA RLDEELNKVNQFHKPKETEFLERGEILKKQLETLAELKQILSDRKKRNLSGSNSHRSFSS SVRNSDFSAGSPGELSEIQSETSRTDEIIEALERNGVSFINSATRSKTKGGKPKMSLRVD IPDAVAGAEGGIARSIATAMSVLWEELVNNPRSDFTNWKNIQSAEKKIRSAFVELYRGLG LLKTYSSLNMIAFTKIMKKFDKVAGQNASSTYLKVVKRSQFISSDKVVRLMDEVESIFTK HFANNDRKKAMKFLKPHQTKDSHMVTFFVGLFTGCFISLFVIYIILAHLSGIFTSSDQVS YLETVYPVFSVFALLSLHMFMYGCNLYMWKNTRINYTFIFEFAPNTALRYRDAFLMGTTF MTSVVAAMVIHLILRASGFSASQVDTIPGILLLIFICVLICPFNTFYRPTRFCFIRILRK IVCSPFYKVLMVDFFMGDQLTSQIPLLRHLETTGCYFLAQSFKTHEYNTCKNGRYYREFA YLISFLPYFWRAMQCVRRWWDESNPDHLINMGKYVSAMVAAGVRITYARENNDLWLTMVL VSSVVATIYQLYWDFVKDWGLLNPKSKNPWLRDNLVLRNKNFYYLSIALNLVLRVAWIET IMRFRVSPVQSHLLDFFLASLEVIRRGHWNFYRVENEHLNNVGQFRAVKTVPLPFLDRDS DG
Source in vitro E.coli expression system
Gene Names PHO1
Protein Names Recommended name: Phosphate transporter PHO1 Alternative name(s): Protein PHO1 Short name= AtPHO1
Expression Region 1-782
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inositol polyphosphate sensor that associates with transcription factors to regulate inorganic phosphate (Pi) starvation responses
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein, Golgi apparatus, trans-Golgi network membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families SYG1 (TC 2.A.94) family
Tissue Specificity Predominantly in roots, but also weak expression in the lower part of the hypocotyl (PubMed:11971143). In the stellar cells, including the pericycle and xylem parenchyma cells, but not in the cortical or epidermal cells (PubMed:11971143). Expressed in gua
Database Links

KEGG: ath:AT3G23430

STRING: 3702.AT3G23430.1

UniGene: At.23989

Related Products

PHO1 Antibodies

PHO1 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

PHO1 Proteins

PHO1 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.