Recombinant Arabidopsis thaliana Phosphate transporter PHO1 (PHO1)

Code CSB-CF844594DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
PHO1
Uniprot No.
Alternative Names
PHO1; At3g23430; MLM24.26; Phosphate transporter PHO1; Protein PHO1; AtPHO1
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-782
Target Protein Sequence
MVKFSKELEAQLIPEWKEAFVNYCLLKKQIKKIKTSRKPKPASHYPIGHHSDFGRSLFDP VRKLARTFSDKLFSNSEKPEILQVRRRRGSSETGDDVDEIYQTELVQLFSEEDEVKVFFA RLDEELNKVNQFHKPKETEFLERGEILKKQLETLAELKQILSDRKKRNLSGSNSHRSFSS SVRNSDFSAGSPGELSEIQSETSRTDEIIEALERNGVSFINSATRSKTKGGKPKMSLRVD IPDAVAGAEGGIARSIATAMSVLWEELVNNPRSDFTNWKNIQSAEKKIRSAFVELYRGLG LLKTYSSLNMIAFTKIMKKFDKVAGQNASSTYLKVVKRSQFISSDKVVRLMDEVESIFTK HFANNDRKKAMKFLKPHQTKDSHMVTFFVGLFTGCFISLFVIYIILAHLSGIFTSSDQVS YLETVYPVFSVFALLSLHMFMYGCNLYMWKNTRINYTFIFEFAPNTALRYRDAFLMGTTF MTSVVAAMVIHLILRASGFSASQVDTIPGILLLIFICVLICPFNTFYRPTRFCFIRILRK IVCSPFYKVLMVDFFMGDQLTSQIPLLRHLETTGCYFLAQSFKTHEYNTCKNGRYYREFA YLISFLPYFWRAMQCVRRWWDESNPDHLINMGKYVSAMVAAGVRITYARENNDLWLTMVL VSSVVATIYQLYWDFVKDWGLLNPKSKNPWLRDNLVLRNKNFYYLSIALNLVLRVAWIET IMRFRVSPVQSHLLDFFLASLEVIRRGHWNFYRVENEHLNNVGQFRAVKTVPLPFLDRDS DG
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inositol polyphosphate sensor that associates with transcription factors to regulate inorganic phosphate (Pi) starvation responses. Probably acts by binding inositol polyphosphate via its SPX domain. Acts as a Pi exporter, mediating efflux of Pi out of cells. Transfers Pi from the epidermal and cortical cells to the root xylem vessels. Involved in the transfer of Pi from roots to shoots. Involved in abscisic acid (ABA) induction of stomatal closure and ABA repression of stomatal opening.
Gene References into Functions
  1. The Arabidopsis Pi exporters PHO1 and PHOH1 are expressed in the chalazal seed coat (CZSC) of developing seeds. PHO1 is additionally expressed in developing ovules. Phosphorus (P) content and Pi flux between the seed coat and embryo were analyzed in seeds from grafts between WT roots and scions from either pho1, phoh1, or the pho1 phoh1 double mutant. PMID: 28943092
  2. Genome-wide association mapping identified PHOSPHATE 1 (PHO1) and genes such as Root System Architecture 1 (RSA1) associated with differences in root allometry, a highly plastic trait capturing the distribution of lateral roots along the primary axis. PMID: 23980140
  3. An important role of the EXS domain of PHO1 in a root-to-shoot signaling pathway linking phosphate deficiency response PMID: 26546667
  4. AtWRKY42 modulated Pi homeostasis by regulating the expression of PHO1 and PHT1;1 to adapt to environmental changes in inorganic phosphate (Pi) availability. PMID: 25733771
  5. PHR1 and PHO1 participate in the coregulation of Zn and Pi homeostasis. PMID: 24420568
  6. Expression of PHO1 in guard cells of Arabidopsis thaliana is required for full stomatal responses to abscisic acid. PMID: 22612335
  7. PHO1 can trigger Pi export in ectopic plant cells, strongly indicating that PHO1 is itself a Pi exporter. PMID: 22449068
  8. PHO1 over-expression in the shoot of Arabidopsis thaliana led to a two- to threefold increase in shoot inorganic phosphate content and a severe reduction in shoot growth. PMID: 21309867
  9. Reduction of PHO1 expression leads to wild-type growthof plants in phosphate-deficient media, despite Pi deficiency. PMID: 21288266
  10. Our results demonstrate that WRKY6 and WRKY42 are involved in Arabidopsis responses to low Pi stress by regulation of PHO1 expression. PMID: 19934380

Show More

Hide All

Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
SYG1 (TC 2.A.94) family
Tissue Specificity
Predominantly in roots, but also weak expression in the lower part of the hypocotyl. In the stellar cells, including the pericycle and xylem parenchyma cells, but not in the cortical or epidermal cells. Expressed in guard cells.
Database Links

KEGG: ath:AT3G23430

STRING: 3702.AT3G23430.1

UniGene: At.23989

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1