Recombinant Arabidopsis thaliana Potassium channel KAT2 (KAT2)

Code CSB-CF655727DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
KAT2
Uniprot No.
Alternative Names
KAT2; At4g18290; T9A21.140; Potassium channel KAT2
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-697
Target Protein Sequence
MSISCTRNFFKRFCVEEYNMDTFKHSSFLSADLLPSLGARINQSTKLRKHIISPFDPRFR GWEMWLVILVIYSAWICPFEFAFITYKKDALFIIDNIVNGFFAIDIILTFFVAYLDSHSY LLVDKPKKIAIRYLSTWFAFDVCSTAPFQSLSLLFKYNGSEIGFRVLSMLRLWRLRRVSS LFARLEKDIRFNYFWTRCTKLISVTLFAVHCAGCFAYLIADQYHDPTKTWIGAVYPNFKE TSVWSRYVTALYWSITTLTTTGYGDLHAENPREMLFFVFFMLFNLGFTSYLIGNMTNLVV HWTSRTRNFRDTVRAASEFASRNQLPPNIQDQMLSHICLKFKTEGLKQQEALNGLPKAIR SSIANYLFFPIVQNVYLFHGVSRNFLFQLVSDIDAEYFPPREDVILQNEAPTDLYILVSG AVDFTVYVGEEDQVQGKAVVGDAFGEIGVLCYTPQPFTVRTTELSQILRISKKSLMSAMR AHVEDGRVIMNNLFMKLRGQQSIAIDDPNSEPESLLKEWLVGGSKTGEGNASDQGHGHKY LQLHDSENIDMGSTEWRDSRRSGYGETKRVREHTIEIEEGEKPNKEFDGKGCSDADLTSF EFHSQEAYPYCRSNIQIKQHEAAKPKDKRVTIHLKSRDKDLSKLIILPASIEELLRLAGE KFGYSFTKVTNAENAEIDDEDVIRDGDHLYILINENS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Highly selective inward-rectifying potassium channel. This voltage-dependent channel could mediate long-term potassium influx into guard cells leading to stomatal opening. Assuming opened or closed conformations in response to the voltage difference across the membrane, the channel is activated by hyperpolarization. The channel activity is enhanced upon external acidification.
Gene References into Functions
  1. The Arabidopsis K(+) channel KAT1 complements in K(+)-limited medium the growth of the K(+) uptake defective Saccharomyces cerevisiae mutant strain CY162, while another K(+) channel, AKT2, does not. PMID: 28933647
  2. CPK13 reduces stomatal aperture through its inhibition of the guard cell-expressed KAT2 and KAT1 channels. PMID: 25037208
  3. The nine-amino acid stretch 312TVRAASEFA320 that composes the first C-linker alpha-helix located just below the pore is a crucial determinant of KAT2 channel activity. PMID: 24406792
  4. KAT2 contributes to the synthesis of substituted hydroxybenzoylcholines.KAT2 plays the primary role in benzoic acid synthesis. PMID: 24254312
  5. KAT2 was able to re-locate AtKC1 fused to GFP from endomembranes to the plasma membrane, indicating that heteromeric AtKC1-KAT2 channels are efficiently targeted to the plasma membrane. PMID: 21518051
  6. KAT2 may function downstream of an important WRKY transcription repressor WRKY40, which may link KAT2 with the ABA receptor ABAR/CHLH-mediated signaling. PMID: 21257607

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Potassium channel family, Plant (TC 1.A.1.4) subfamily
Tissue Specificity
Expressed in guard cells of hypocotyls, stems leaves and petioles. Detected also in the phloem of minor veins and in flower at a lower level.
Database Links

KEGG: ath:AT4G18290

STRING: 3702.AT4G18290.1

UniGene: At.431

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1