Recombinant Arabidopsis thaliana Protein ECHIDNA(ECH)

Code CSB-CF847512DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8LEK2
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MDPNNQIQAPVENYANPRTCLFHVLFKGAALAFYILSALFFNSFVIIFVVTVLLAALDFW VVKNVSGRILVGLRWWNEINDLGESVWKFESLDQESLARMNKKDSWLFWWTLYLAAAAWF ILGVFSLIRFQADYLLVVGVCLSLNVANIIGFTKCKKDAKKQFQQFASQTIASRFQSTVQ SAFTLV
Source in vitro E.coli expression system
Gene Names ECH
Protein Names Recommended name: Protein ECHIDNA
Expression Region 1-186
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates trans-Golgi-network trafficking and cell elongation. Required for keeping the appropriate balance between secretory trafficking and vacuolar targeting of a subset of proteins.
Subcellular Location Golgi apparatus, trans-Golgi network membrane, Multi-pass membrane protein, Early endosome membrane, Multi-pass membrane protein
Protein Families TVP23 family
Database Links

KEGG: ath:AT1G09330

STRING: 3702.AT1G09330.1

UniGene: At.43661

Related Products

ECH Antibodies

ECH Antibodies for Arabidopsis thaliana (Mouse-ear cress)

ECH Proteins

ECH Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.