Recombinant Arabidopsis thaliana Protein REVERSION-TO-ETHYLENE SENSITIVITY1 (RTE1)

Code CSB-CF520530DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
RTE1
Uniprot No.
Alternative Names
RTE1; At2g26070; T19L18.12; Protein REVERSION-TO-ETHYLENE SENSITIVITY1
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-250
Target Protein Sequence
MSRGRGVPMMDLKRSYDVEDRVVSVSIPSIIEADEADLWPLPEIDTKKSKFPCCIVWTPL PVVSWLAPFIGHIGLCREDGVILDFAGSNFINVDDFAFGPPARYLQLDRTKCCLPPNMGG HTCKYGFKHTDFGTARTWDNALSSSTRSFEHKTYNIFTCNCHSFVANCLNRLCYGGSMEW NMVNVAILLMIKGKWINGSSVVRSFLPCAVVTSLGVVLVGWPFLIGLSSFSLLLFAWFII ATYCFKNIIT
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts at an early step in the ethylene signaling pathway. Positively regulates ETR1, leading to the negative regulation of ethylene responses.
Gene References into Functions
  1. the regulatory function of Arabidopsis RTH via its homolog RTE1 in the ethylene signaling pathway PMID: 28541511
  2. Gene expression involved in ethylene signaling suppression was not reduced by the hpr1-5 mutation, which indicates selectivity of HPR1 for RTE1 expression affecting the consequent ethylene response. PMID: 25680185
  3. Cb5 and RTE1 are functional partners in promoting ETR1-mediated repression of ethylene signaling. PMID: 24635651
  4. The roles of CTR1 and RTE1 in ETR1 N-terminal signaling, were evaluated. PMID: 22566492
  5. a high affinity association of RTE1 and ETR1 is important in the regulation of ETR1. PMID: 20952388
  6. RTE1 is a negative regulator of ethylene signaling and suggest that RTE1 plays an important role in ETR1 function [RTE1]. PMID: 16682642
  7. Our results suggest specificity of the RTE1 function to ETR1 and that endomembranes may play a role in the ethylene signal transduction. PMID: 17644624
  8. we demonstrated the subcellular co-localization of RTE1 and ETR1. These findings support and enhance the genetic model that RTE1 plays a role in regulating ETR1. PMID: 17999643
  9. RTE1 targets the ethylene-binding domain of ETR1 and positively regulates the ethylene receptor, independent of RAN1 activity. PMID: 18643990
  10. Dominant etr1 mutations that require RTE1 to confer ethylene insensitivity are essentially silent when transferred to the identical conserved postitions in other ethylene receptor genes. PMID: 19369589

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Strongly expressed in 1-4-day-old seedlings in the apical hook, cotyledons, root vascular tissue, root tip and root hairs, with little or no expression in the hypocotyl. In light-grown seedlings, expression could also be seen in the apex and young leaves,
Database Links

KEGG: ath:AT2G26070

STRING: 3702.AT2G26070.1

UniGene: At.28087

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1