Recombinant Arabidopsis thaliana Protein TIC 40, chloroplastic (TIC40)

Code CSB-CF884298DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
TIC40
Uniprot No.
Alternative Names
TIC40; PDE120; At5g16620; MTG13.6; Protein TIC 40, chloroplastic; Protein PIGMENT DEFECTIVE EMBRYO 120; Translocon at the inner envelope membrane of chloroplasts 40; AtTIC40
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
77-447
Target Protein Sequence
SIFSSSRDQQTTSVASPSVPVPPPSSSTIGSPLFWIGVGVGLSALFSYVTSNLKKYAMQT AMKTMMNQMNTQNSQFNNSGFPSGSPFPFPFPPQTSPASSPFQSQSQSSGATVDVTATKV ETPPSTKPKPTPAKDIEVDKPSVVLEASKEKKEEKNYAFEDISPEETTKESPFSNYAEVS ETNSPKETRLFEDVLQNGAGPANGATASEVFQSLGGGKGGPGLSVEALEKMMEDPTVQKM VYPYLPEEMRNPETFKWMLKNPQYRQQLQDMLNNMSGSGEWDKRMTDTLKNFDLNSPEVK QQFNQIGLTPEEVISKIMENPDVAMAFQNPRVQAALMECSENPMNIMKYQNDKEVMDVFN KISQLFPGMTG
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in protein precursor import into chloroplasts. Part of the motor complex consisting of a co-chaperone (TIC40) and a chaperone (HSP93) associated with the import channel (TIC110). Causes the release of bound transit peptides from TIC110 and stimulates ATP hydrolysis by HSP93. Involved in reinsertion of proteins from the chloroplast stroma into the inner membrane.
Gene References into Functions
  1. Tic40 is a multifunctional protein that, in addition to its originally described role in protein import, is able to influence downstream processes leading to thylakoid biogenesis. PMID: 28684427
  2. Interaction of Tic40-NP and Hsp93 stimulates ATP hydrolysis of Hsp93, but the hydrolysis is abolished in both N320A and N329A mutants of Tic40-NP. PMID: 22888115
  3. The interaction of Tic110, Tic40 and Hsp93 in A. thaliana chloroplast protein transport is described. [AtTic40] PMID: 15659100
  4. The interaction of Tic40 with rhomboid proteases in a yeast mitochondria-based assay is reported. PMID: 17327256
  5. analysis of similarity between the chloroplast translocon component, Tic40, and the human co-chaperone, Hsp70-interacting protein PMID: 17535810
  6. the sorting of AtTic40 requires a bipartite transit peptide, which is first cleaved by the stromal processing peptidase (SPP), thus generating a soluble AtTic40 stromal intermediate. PMID: 17883373
  7. In a Tic40 mutant soluble Tic40 and Tic110N intermediates accumulated in the chloroplast stroma due to a slower rate of reinsertion into the inner membrane. PMID: 18657235

Show More

Hide All

Subcellular Location
Plastid, chloroplast inner membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in seedlings, flowers, leaves, stems and roots.
Database Links

KEGG: ath:AT5G16620

STRING: 3702.AT5G16620.1

UniGene: At.25049

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1