Recombinant Arabidopsis thaliana Protein TOO MANY MOUTHS (TMM)

Code CSB-CF879826DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
TMM
Uniprot No.
Alternative Names
TMM; RLP17; At1g80080; F18B13.16; Protein TOO MANY MOUTHS; Receptor-like protein 17; AtRLP17
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
24-496
Target Protein Sequence
FTVITSDSTAPSALIDGPQTGFTMTNDGARTEPDEQDAVYDIMRATGNDWAAAIPDVCRG RWHGIECMPDQDNVYHVVSLSFGALSDDTAFPTCDPQRSYVSESLTRLKHLKALFFYRCL GRAPQRIPAFLGRLGSSLQTLVLRENGFLGPIPDELGNLTNLKVLDLHKNHLNGSIPLSF NRFSGLRSLDLSGNRLTGSIPGFVLPALSVLDLNQNLLTGPVPPTLTSCGSLIKIDLSRN RVTGPIPESINRLNQLVLLDLSYNRLSGPFPSSLQGLNSLQALMLKGNTKFSTTIPENAF KGLKNLMILVLSNTNIQGSIPKSLTRLNSLRVLHLEGNNLTGEIPLEFRDVKHLSELRLN DNSLTGPVPFERDTVWRMRRKLRLYNNAGLCVNRDSDLDDAFGSKSGSTVRLCDAETSRP APSGTVQHLSREEDGALPDGATDVSSTSKSLGFSYLSAFFLVFPNFIFMLISS
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes cell fate progression in stomatal development. In leaves, needed to correctly orient spacing divisions, to limit the number of asymmetric divisions in neighbor cells, and to promote the asymmetric (amplifying) divisions of meristemoids. In stems, promotes the conversion of meristemoids into guard mother cells (GMC). Positively regulates CAPRICE (CPC) expression in differentiating stomaless-forming cell files. Forms constitutive complexes with ERECTA and ERL1 involved in the recognition of the stomatal regulatory peptides EPF1, EPF2 and EPFL9/STOMAGEN. Modulates the activity of the ligand-receptor pairs EPF2-ERECTA and EPF1-ERL1 in stomatal development. Functions in a combinatorial specific manner with the ERECTA-family (ERf) receptor kinases in the regulation of the immune response.
Gene References into Functions
  1. Data demonstrate that TMM dictates the specificity of ERECTA family for the perception of different epidermal patterning factor peptides (EPfs), thus functioning as a specificity switch for the regulation of the activities of ERfs. PMID: 28536146
  2. Brassinosteroid organ-specific effects on stomatal production might coordinate with the TMM organ-specific actions. PMID: 25234048
  3. TMM was involved in Abscisic Acid (ABA) signaling transduction. Overexpression of TMM resulted in the reduction of leaf trichomes and their branches. PMID: 24553751
  4. CHAL and the EPFs both act through ER family receptors to repress stomatal production, but are subject to opposite regulation by TMM PMID: 20056678
  5. TMM interacts with other proteins to modulate precursor cell fate and progression in an organ and domain-specific manner. PMID: 18979118

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
RLP family
Tissue Specificity
In epidermal cells of developing shoots and leaves, but not in roots. Expressed in the stomatal cell lineage in the developing epidermis. Accumulates strongly in meristemoid mother cells (MMC) and meristemoids, somewhat less in meristemoid sister cells (s
Database Links

KEGG: ath:AT1G80080

STRING: 3702.AT1G80080.1

UniGene: At.33989

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×