Recombinant Arabidopsis thaliana Translocase of chloroplast 33, chloroplastic (TOC33)

Code CSB-CF521283DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
TOC33
Uniprot No.
Alternative Names
TOC33; PPI1; At1g02280; T7I23.11; Translocase of chloroplast 33, chloroplastic; AtToc33; 33 kDa chloroplast outer envelope protein; Plastid protein import 1
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-297
Target Protein Sequence
MGSLVREWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQ VVRVSPFQAEGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVL LYVDRLDVYRVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSD SLLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDV ATNQRKAIHVDKKMVDGSYSDDKGKKLIPLIIGAQYLIVKMIQGAIRNDIKTSGKPL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
GTPase involved in protein precursor import into chloroplasts. Seems to recognize chloroplast-destined precursor proteins and regulate their presentation to the translocation channel through GTP hydrolysis. Binds GTP, GDP, XTP, but not ATP. Probably specialized in the import of nuclear encoded photosynthetic preproteins from the cytoplasm to the chloroplast, especially during early development stages.
Gene References into Functions
  1. [review] Homodimerization of Toc33 prevents nucleotide exchange, thereby locking the receptor in the guanosine diphosphate (GDP)-loaded state and preventing further activity. PMID: 21568939
  2. Pre-protein binding induces a dissociation of the Toc33 homodimer and results in exchange of guanosine diphosphate (GDP) for guanosine triphosphate (GTP). PMID: 21434866
  3. Neither nucleotide binding nor dimerization at atToc33 is essential for chloroplast import. PMID: 20444229
  4. The role of Toc33 protein in biological transport of proteins in the protochlorophyllide-dependent pathway in A. thaliana. PMID: 15773849
  5. The data suggest that atToc33 phosphorylation may not play an important role in vivo. PMID: 16412428
  6. Chloroplast biogenesis and photosynthetic activity are impaired in the mutants during the early developmental stage, which is consistent with the requirement of atToc33 in young photosynthetic tissues. PMID: 18054337
  7. Dimerization is independent of nucleotide loading state, based on crystal structures of dimeric Pisum sativum Toc34 and monomeric Arabidopsis thaliana Toc33. PMID: 18400179
  8. Toc33 GTPase homodimerization and protein translocation into chloroplasts are pH sensitive. PMID: 19001421

Show More

Hide All

Subcellular Location
Plastid, chloroplast outer membrane; Single-pass membrane protein. Note=May contain beta barrel transmembrane regions.
Protein Families
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, AIG1/Toc34/Toc159-like paraseptin GTPase family, TOC34 subfamily
Tissue Specificity
Mostly expressed in seedlings and flowers, and, to a lower extent, in roots, stems, and leaves.
Database Links

KEGG: ath:AT1G02280

STRING: 3702.AT1G02280.1

UniGene: At.10710

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1