Recombinant Arabidopsis thaliana bZIP transcription factor 60 (BZIP60)

Code CSB-CF874912DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
BZIP60
Uniprot No.
Alternative Names
BZIP60; At1g42990; F13A11.5; bZIP transcription factor 60; AtbZIP60
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-295
Target Protein Sequence
MAEEFGSIDLLGDEDFFFDFDPSIVIDSLPAEDFLQSSPDSWIGEIENQLMNDENHQEES FVELDQQSVSDFIADLLVDYPTSDSGSVDLAADKVLTVDSPAAADDSGKENSDLVVEKKS NDSGSEIHDDDDEEGDDDAVAKKRRRRVRNRDAAVRSRERKKEYVQDLEKKSKYLERECL RLGRMLECFVAENQSLRYCLQKGNGNNTTMMSKQESAVLLLESLLLGSLLWLLGVNFICL FPYMSHTKCCLLRPEPEKLVLNGLGSSSKPSYTGVSRRCKGSRPRMKYQILTLAA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription factor involved in the unfolded protein response (UPR). Acts during endoplasmic reticulum stress (ER) by activating unfolded protein response (UPR) target genes via direct binding to the UPR element (UPRE). Plays a role in plant immunity and abiotic stress responses.
Gene References into Functions
  1. RLG1 proteins derived from transgene were mainly found in the cytoplasm; however, some were in the microsomal fraction, possibly on the ER membrane. PMID: 26820526
  2. bZIP60 binds directly to UPRE-III-containing DNA, and regulates NAC103. PMID: 23869562
  3. overexpression of the AtbZIP60 gene in transgenic cell lines improved salt, drought, and cold stress tolerances by regulating expression of Ca(2+)-dependent protein kinase genes. PMID: 23275191
  4. AtPDI gene expression was investigated in different tissues, in response to chemically induced unfolded protein response (UPR), and in null mutants of UPR signaling mediators (AtIRE1-2 and AtbZIP60). PMID: 18574595
  5. bZIP60 is involved in the plant endoplasmic reticulum stress response and is upregulated during normal development in anther cells. [bZIP60] PMID: 19017746
  6. possible mechanisms of AtbZIP60's action in the nucleus are discussed PMID: 19352029

Show More

Hide All

Subcellular Location
[Isoform 1]: Endoplasmic reticulum membrane; Single-pass membrane protein.; [Isoform 2]: Nucleus. Note=The bZIP domain is translocated into the nucleus in response to ER stress.
Protein Families
BZIP family
Tissue Specificity
Expressed in seedlings, rosette and cauline leaves, stems, buds, flowers, siliques, immature seeds, anthers and pollen grains.
Database Links

KEGG: ath:AT1G42990

STRING: 3702.AT1G42990.1

UniGene: At.21271

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1