Recombinant Bos indicus Growth hormone receptor(GHR)

Code CSB-CF009411BUL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P79108
Storage Buffer Tris-based buffer,50% glycerol
Species Bos indicus (Zebu)
Sequence FSGSEATPAFLVRASQSLQILYPVLETNSSGNPKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEWKECPDYVSAGENSCYFNSSYTSVWTPYCIKLTSNGGIVDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIHADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLMVTSVPMYSLRLDKEYEVRVRTRQRNTEKYGKFSEVLLITFPQMNPSACEEDFQFPWFLIIMFGILGLAVTLFLLIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKHEFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSNDHEKSLNIFGAKDDDSGRTSCYEPDILEADFHVSDMCDGTSEVAQPQRLKGEADISCLDQKNQNNSPSNDAAPANQQPSVIHVEENKPRPLLIGGTESTHQAVHHQLSNPSSLANIDFYAQVSDITPAGNVVLSPGQKNKTGNPQCDTHPEVVTSCQANFIVDNAYFCEVDAKKYIALAPHVEAESHVEPSFNQEDIYITTESLTTTAGRSGTAEHVPSSEIPVPDYTSIHIVQSPQGLVLNATALPLPDKEFLSSCGYVSTDQLNKIMP
Source in vitro E.coli expression system
Gene Names GHR
Protein Names Recommended name: Growth hormone receptor Short name= GH receptor Alternative name(s): Somatotropin receptor Cleaved into the following chain: 1. Growth hormone-binding protein Short name= 2. GH-binding protein Short name= 3. GHBP Alternati
Expression Region 19-634
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway (By similarity).
Subcellular Location Cell membrane, Single-pass type I membrane protein, Note=On growth hormone binding, GHR is ubiquitinated, internalized, down-regulated and transported into a degradative or non-degradative pathway, SUBCELLULAR LOCATION: Growth hormone-binding protein: Secreted
Protein Families Type I cytokine receptor family, Type 1 subfamily
Database Links

UniGene: Bt.111379

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway

Related Products

GHR Proteins

GHR Proteins for Bos indicus (Zebu)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.