Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-CF664873BO |
Size | Pls inquire |
Source | in vitro E.coli expression system |
Have Questions? | Leave a Message or Start an on-line Chat |
Target Names | OMA1 |
Uniprot No. | Q3SZN3 |
Alternative Names | OMA1; Metalloendopeptidase OMA1, mitochondrial; Overlapping with the m-AAA protease 1 homolog |
Species | Bos taurus (Bovine) |
Expression Region | 46-523 |
Target Protein Sequence | IVNKSLGLGVNHGDRWTPLPENFLFYRTFNTKRKGCLLSSRSKEIWMISRKCTAWTDSFS RQLPMKNVPVVPAHSMSHPLNCLPTRDIRSFHTSPRCQAAPAPLLLMILKPAQKLLAIIV GRGIRKWWQALPPNKKELFKESLRKNKWKLFLGLSSFGLLFVVFYFTHLEVSPVTGRSKL LILGKEHFRLLSELEYEAWMEEFKNDMLTEKDARYVAVKAVVHHLIECNQDIPGISEINW IIHVVDSPDINAFVLPNGQVFVFTGLLNSVTDIHQLSFLLGHEIAHAVLEHAAEKASLVH LLDFLGLIFLTTIWAICPRDSLALLGQWIQSKLQEFLFDRPYSRTLEAEADRIGLQLAAK ACVDVRASSVFWQQMEFAESLHGHPKLPEWLSTHPSHGNRAEHLDRLIPQALKIRETCNC PPLSGPDPRLLFKLSMKNFLEAEKEDLNITVKQKMDALPIQNQKQIPLTCIVDKRTGS |
Protein Length | Full Length of Mature Protein |
Tag Info | The following tags are available. N-terminal His-tagged Tag-Free The tag type will be determined during production process. If
you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time
may differ from different purchasing way or location, please kindly consult your local distributors
for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Metalloprotease that is part of the quality control system in the inner membrane of mitochondria. Activated in response to various mitochondrial stress, leading to the proteolytic cleavage of target proteins, such as OPA1, UQCC3 and DELE1. Following stress conditions that induce loss of mitochondrial membrane potential, mediates cleavage of OPA1 at S1 position, leading to OPA1 inactivation and negative regulation of mitochondrial fusion. Also acts as a regulator of apoptosis: upon BAK and BAX aggregation, mediates cleavage of OPA1, leading to the remodeling of mitochondrial cristae and allowing the release of cytochrome c from mitochondrial cristae. In depolarized mitochondria, may also act as a backup protease for PINK1 by mediating PINK1 cleavage and promoting its subsequent degradation by the proteasome. May also cleave UQCC3 in response to mitochondrial depolarization. Also acts as an activator of the integrated stress response (ISR): in response to mitochondrial stress, mediates cleavage of DELE1 to generate the processed form of DELE1 (S-DELE1), which translocates to the cytosol and activates EIF2AK1/HRI to trigger the ISR. Its role in mitochondrial quality control is essential for regulating lipid metabolism as well as to maintain body temperature and energy expenditure under cold-stress conditions. Binds cardiolipin, possibly regulating its protein turnover. Required for the stability of the respiratory supercomplexes.
|
Subcellular Location | Mitochondrion inner membrane; Single-pass membrane protein. |
Protein Families | Peptidase M48 family |
Database Links |
KEGG: bta:506223 STRING: 9913.ENSBTAP00000023044 UniGene: Bt.27779 |