Recombinant Bovine Oxidized low-density lipoprotein receptor 1 (OLR1)

Code CSB-CF016331BO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
OLR1; LOX1; Oxidized low-density lipoprotein receptor 1; Ox-LDL receptor 1; Lectin-like oxidized LDL receptor 1; LOX-1; Lectin-like oxLDL receptor 1; bLOX-1; Lectin-type oxidized LDL receptor 1
Species
Bos taurus (Bovine)
Expression Region
1-270
Target Protein Sequence
MTVDDPKGMKDQLDQKPNGKTAKGFVSSWRWYPAAVTLGVLCLGLLVTVILLILQLSQVSDLIKKQQANITHQEDILEGQILAQRRSEKSAQESQKELKEMIETLAHKLDEKSKKLMELHRQNLNLQEVLKEAANYSGPCPQDWLWHEENCYQFSSGSFNWEKSQENCLSLDAHLLKINSTDELEFIQQMIAHSSFPFWMGLSMRKPNYSWLWEDGTPLTPHLFRIQGAVSRMYPSGTCAYIQRGTVFAENCILTAFSICQKKANLLRAQ
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram-positive bacteria.
Gene References into Functions
  1. Endothelial LOX-1 overexpression in an atherosclerosis-prone LDL receptor knockout mice impairs endothelial function, proving its importance in the development of atherosclerosis. PMID: 29096854
  2. bta-miR-370 has a negative regulatory effect on the OLR1 gene at both the gene and protein expression levels and has a role in lipid metabolism in bovine adipocytes PMID: 28294375
  3. Overexpression of LOX-1 leads to the attenuation of protective autophagy response in aortic endothelial cells. PMID: 25703423
  4. These results imply that the 3' UTR SNP of the OLR1 gene is a strong candidate marker for selection in cattle breeding programs. PMID: 23910552
  5. Our data indicate that blocking the LOX-1 receptor signal pathway might be a promising way to improve steroid hormone concentrations in metabolically highly active female mammals PMID: 24115745
  6. In the present study, we show that inhibition of LOX-1 leads to a rearrangement of ceramide from the basal membrane toward the Golgi apparatus PMID: 24710763
  7. The downregulation of eNOS by ox-low-density lipoprotein, as driven by LOX-1-mediated endoplasmic stress, is associated with the PI3K-Akt-eNOS signaling pathway. PMID: 24085225
  8. 3'-UTR SNP assoicated with milk composition traits and somatic cell score PMID: 22365237
  9. Disruption of lipid packing of cholesterol-rich membrane domains plays a key role in oxidized low-density lipoprotein (oxLDL)-induced changes in endothelial biomechanics. PMID: 20410437
  10. Oxidized low-density lipoprotein receptor (OLR1) single nucleotide polymorphism haplotype is associated with milk fat yield and fat percentage PMID: 16606746
  11. synergistic effects of cyclic tensile stretch load and ox-LDL on cell viability and proteoglycan synthesis in chondrocytes, which may be mediated through enhanced expression of LOX-1 PMID: 16795046
  12. Upregulates VEGF expression in articular cartilage, at least in part, through activation of PPAR-gamma. PMID: 16904074
  13. Mediation of electronegative low-density lipoprotein signaling by LOX-1: a possible mechanism of endothelial apoptosis. PMID: 19150883
  14. ox-LDL binding to LOX-1 induces stress-induced senescence of chondrocytes and suppression of telomerase activity. Oxidized LDL may play an important role in the pathogenesis of osteoarthritis by inducing chondrocyte senescence. PMID: 19790061

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor. Cell membrane; Single-pass type II membrane protein. Membrane raft. Secreted.
Tissue Specificity
Highly expressed in endothelial cells, aortic intima and lung. Expressed at low level in other tissues.
Database Links

KEGG: bta:281368

STRING: 9913.ENSBTAP00000005975

UniGene: Bt.367

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×