Recombinant Bovine Oxidized low-density lipoprotein receptor 1(OLR1)

Code CSB-CF016331BO
Size Pls inquire other sizes
Source in vitro E.coli expression system

Product Details

Target Names OLR1
Uniprot No. P79391
Species Bos taurus (Bovine)
Expression Region 1-270
Target Protein Sequence MTVDDPKGMKDQLDQKPNGKTAKGFVSSWRWYPAAVTLGVLCLGLLVTVILLILQLSQVSDLIKKQQANITHQEDILEGQILAQRRSEKSAQESQKELKEMIETLAHKLDEKSKKLMELHRQNLNLQEVLKEAANYSGPCPQDWLWHEENCYQFSSGSFNWEKSQENCLSLDAHLLKINSTDELEFIQQMIAHSSFPFWMGLSMRKPNYSWLWEDGTPLTPHLFRIQGAVSRMYPSGTCAYIQRGTVFAENCILTAFSICQKKANLLRAQ
Protein Length full length protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.
Still Have Questions? Start a Chat

Target Data

Function Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram-positive bacteria.
Subcellular Location Cell membrane, Lipid-anchor, Cell membrane, Single-pass type II membrane protein, Membrane raft, Secreted
Tissue Specificity Highly expressed in endothelial cells, aortic intima and lung. Expressed at low level in other tissues.
Database Links

KEGG: bta:281368

STRING: 9913.ENSBTAP00000005975

UniGene: Bt.367

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.