Recombinant Bovine cGMP-gated cation channel alpha-1 (CNGA1)

Code CSB-CF005642BO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CNGA1; CNCG; CNCG1; cGMP-gated cation channel alpha-1; Cyclic nucleotide-gated cation channel 1; Cyclic nucleotide-gated channel alpha-1; CNG channel alpha-1; CNG-1; CNG1; Cyclic nucleotide-gated channel, photoreceptor; Rod photoreceptor cGMP-gated channel subunit alpha
Species
Bos taurus (Bovine)
Expression Region
1-690
Target Protein Sequence
MKKVIINTWHSFVNIPNVVGPDVEKEITRMENGACSSFSGDDDDSASMFEESETENPHAR DSFRSNTHGSGQPSQREQYLPGAIALFNVNNSSNKEQEPKEKKKKKKEKKSKPDDKNENK KDPEKKKKKEKDKDKKKKEEKGKDKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNWTM IIARACFDELQSDYLEYWLAFDYLSDVVYLLDMFVRTRTGYLEQGLLVKEERKLIDKYKS TFQFKLDVLSVIPTDLLYIKFGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISN LVMYIIIIIHWNACVYFSISKAIGFGNDTWVYPDVNDPDFGRLARKYVYSLYWSTLTLTT IGETPPPVRDSEYFFVVADFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMH FRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFAD CEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGS YFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKGMLEEKGKQI LMKDGLLDINIANAGSDPKDLEEKVTRMESSVDLLQTRFARILAEYESMQQKLKQRLTKV EKFLKPLIDTEFSAIEGSGTESGPTDSTQD
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Subunit of the rod cyclic GMP-gated cation channel, which is involved in the final stage of the phototransduction pathway. When light hits rod photoreceptors, cGMP concentrations decrease causing rapid closure of CNGA1/CNGB1 channels and, therefore, hyperpolarization of the membrane potential.
Gene References into Functions
  1. These results suggest that restraining the A' helix to the plasma membrane potentiates CNGA1 channel opening. PMID: 26969165
  2. Conformation changes of CNGA1 associated with its gating function are reported. PMID: 25963832
  3. Data show that when Pro365 is replaced with a threonine in cyclic nucleotide gated channel alpha 1 (CNGA1), cesium Cs+ permeation is nearly abolished. PMID: 26100907
  4. Stabilizing the C-helix of intact CNGA1 channels by metal binding to a pair of histidines promoted channel opening. PMID: 23525108
  5. A ring of threonines in the inner vestibule of the pore of CNGA1 channels constitutes a binding site for permeating ions PMID: 22869010
  6. Three CNGA1 subunits and a single CNGB1 subunit form the rod cyclic nucleotide-gated ion channels. PMID: 21878911
  7. Existence of a strong coupling between the upper portion of the S6 helix provides a simple molecular mechanism for CNGA1 gating. PMID: 19289572
  8. The heteromeric cyclic nucleotide-gated channel adopts a 3A:1B stoichiometry PMID: 12432397
  9. Data suggest that the native rod cyclic nucleotide-gated (CNG) channel is a tetramer composed of three A1 and one B1 subunit. PMID: 12467591
  10. Data show that the cyclic nucleotide-gated (CNG) channel contains three CNGA1 subunits and only one CNGB1 subunit. PMID: 12467592
  11. Structural models of the tetrameric cyclic nucleotide gated channel alpha 1 from bovine rod is presented. PMID: 15792804
  12. In CNGA1 channels, pore gating is involved in the rate-limiting reactions determining the activation time course in the sequence of events between cGMP binding and pore opening. PMID: 16473910
  13. These observations suggest that these effects are mediated by the formation of a disulfide bond (S-S) between F380C and the endogenous Cys-314 in the S5 segment. PMID: 16513780
  14. analyze in detail the molecular mechanisms underlying Cd2+ inhibition and longer cross-linkers in mutant CNGA1 channels PMID: 19132361
  15. detailed analysis of conformational changes of the S6 domain and C-linker during gating of CNGA1 channels PMID: 19488745

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGA1 subfamily
Tissue Specificity
Expressed in the retina, in rod cells (at protein level).
Database Links

KEGG: bta:281700

STRING: 9913.ENSBTAP00000002853

UniGene: Bt.53

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1