Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Peptidyl-prolyl cis-trans isomerase D(ppiD)

Code CSB-CF018474BWZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P57550
Storage Buffer Tris-based buffer,50% glycerol
Species Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Sequence MTKYSQARLNSIIVKFILGVIILSLILSTISIYINRDFEKYIATVNGEKISFNLFKKMYFIEREKQKKILGKNFFKFSHNENFTKETYNYVLSQLINNVLLEQYAKNMNYLEVNDNTIKKIIYNSPIFQKNNKFSKERYLNYLTSINSTNHEYINIIKKKINTENLIHTISKSNFILKKEEKNIIKLLSQKRIIKKAIVKIDPSIYKKNITNQEAQIYFKKNQDNFYIPEKFKINFVELKTDNFKIHCENKEIYDWYIRNITQYSTKEKRRYSIIQVKNKQQAISILSRLHNTPEDFSKIAQEQSTDPISSKKDGDIGWISIDLIPDEIKHANLNKKNQISDVIPFHNEFLIVKLNETQIGTQKKIYEVFDSIKKQIKQKKSLDLYNELKNKISNNLKNDPGKIERILKENNILIQETDWFDKKSIPKVLNIPILKQFIFNKKLFQKDTTVKPQFHFIVLKKNQSFLIKIKKFKNKEIQHFENVKKNIIKKLRFIKAIKETKKKSEEIIYDLTQGRKKLFKQSNLYFTDPEIISRYDLSAITSIVFSLPHPQKGKKIYTLYNDKNKNFIIISLEKVYNTNFSEKEKNVILEYLSRHNTEIIFNSILKDLREKSIIKYENIVNK
Source in vitro E.coli expression system
Gene Names ppiD
Protein Names Recommended name: Peptidyl-prolyl cis-trans isomerase D Short name= PPIase D EC= 5.2.1.8 Alternative name(s): Rotamase D
Expression Region 1-623
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function PPIases accelerate the folding of proteins.
Subcellular Location Cell membrane, Single-pass type II membrane protein
Database Links

KEGG: buc:BU478

STRING: 107806.BU478

Pathway Necroptosis
Cellular senescence

Related Products

ppiD Proteins

ppiD Proteins for Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.