Recombinant Cat Beta-3 adrenergic receptor(ADRB3)

Code CSB-CF890583CA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9TST4
Storage Buffer Tris-based buffer,50% glycerol
Species Felis catus (Cat) (Felis silvestris catus)
Sequence MAPWPHGNGSLASWPDAPTLTPNTANTSGLPGVPWAVALAGALLALAVLATVGGNLLVIV AIARTPRLQTMTNVFVTSLATADLVVGLLVVPPGATLALTGHWPLGATGCELWTSVDVLC VTASIETLCALAVDRYLAVTNPLRYGALVTKRRARAAVVLVWVVSAAVSFAPIMSKWWRV GADAEAQRCHSNPHCCAFASNIPYALLSSSVSFYLPLLVMLFVYARVFVVATRQLRLLRG ELGRFPPGESPPAASRSMSPAPAGPCASPAGVPSYGRRPARLLPLREHRALRTLGLIMGT FSLCWLPFFVANVVRALGGPSLVPSPAFLALNWLGYANSAFNPLIYCRSPDFRSAFRRLL CRCRLEERHAAASGAGETSDAPAALTRPAESGLPGGIS
Source in vitro E.coli expression system
Gene Names ADRB3
Protein Names Recommended name: Beta-3 adrenergic receptor Alternative name(s): Beta-3 adrenoreceptor Short name= Beta-3 adrenoceptor
Expression Region 1-398
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. Beta-3 is involved in the regulation of lipolysis and thermogenesis (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB3 sub-subfamily
Database Links

KEGG: fca:493930

STRING: 9685.ENSFCAP00000009674

Pathway Calcium signaling pathway
cGMP-PKG signaling pathway

Related Products

ADRB3 Proteins

ADRB3 Proteins for Felis catus (Cat) (Felis silvestris catus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.