Recombinant Chicken Calcium release-activated calcium channel protein 1(ORAI1)

Code CSB-CF720018CH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5ZL05
Storage Buffer Tris-based buffer,50% glycerol
Species Gallus gallus (Chicken)
Sequence MSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDAEHDYPRGLLIAF SACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIG TLLFLAEVVLLCWVKFLPLKKNPLDPAENSNSSITSGQAAAIASTSIMVPFGLIFIVFAV HFYRSLVSHKTDRQFQELNELAEFAWLQDQLDHRGDAISPAVTHFA
Source in vitro E.coli expression system
Gene Names ORAI1
Protein Names Recommended name: Calcium release-activated calcium channel protein 1 Alternative name(s): Protein orai-1 Transmembrane protein 142A
Expression Region 1-226
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Orai family
Database Links

KEGG: gga:416845

STRING: 9031.ENSGALP00000006734

UniGene: Gga.22197

Pathway Calcium signaling pathway
cAMP signaling pathway

Related Products

ORAI1 Proteins

ORAI1 Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.